Antibodies

Jump to Filters
View as table Download
glucose 6 phosphatase, catalytic subunit (G6PC) Rabbit Polyclonal Antibody
TA334652

USD 539.00

2 Weeks

Rabbit Polyclonal Anti-G6PC Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-G6PC antibody: synthetic peptide directed towards the N terminal of human G6PC. Synthetic peptide located within the following region: NLVFKWILFGQRPYWWVLDTDYYSNTSVPLIKQFPVTCETGPGSPSGHAM
ENPP1 Mouse Monoclonal Antibody [Clone ID: OTI8C7]
TA815741

USD 379.00

In Stock

ENPP1 mouse monoclonal antibody,clone OTI8C7

Applications WB
Reactivities Human
Conjugation Unconjugated
ENPP1 Mouse Monoclonal Antibody [Clone ID: OTI8C7]
CF815741

USD 465.00

3 Days

Carrier-free (BSA/glycerol-free)ENPP1 mouse monoclonal antibody,clone OTI8C7

Applications WB
Reactivities Human
Conjugation Unconjugated
UGT (UGT1A1) Rabbit Polyclonal Antibody
TA332982

USD 365.00

2 Weeks

Rabbit anti-UGT1A1 Polyclonal Antibody

Applications ICC/IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human UGT1A1
beta glucuronidase (GUSB) (Center) Rabbit Polyclonal Antibody
AP51986PU-N

USD 580.00

2 Weeks

beta glucuronidase (GUSB) (Center) rabbit polyclonal antibody, Aff - Purified

Applications FC, IHC, WB
Reactivities Human, Porcine
Conjugation Unconjugated
Immunogen KLH conjugated synthetic peptide between 335 - 362 amino acids from the Center region of Human Beta-glucuronidase
UGT2B15 (Center) Rabbit Polyclonal Antibody
AP54455PU-N

USD 580.00

2 Weeks

UGT2B15 (Center) rabbit polyclonal antibody, Aff - Purified

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen KLH conjugated synthetic peptide between 163-193 amino acids from the Central region of human UGT2B15
UGT (UGT1A9) Rabbit Polyclonal Antibody
TA308133

USD 625.00

In Stock

Rabbit Polyclonal antibody to UGT1A9 (UDP glucuronosyltransferase 1 family, polypeptide A9)

Applications IHC, WB
Reactivities Human, Mouse (Predicted: Rat)
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 291 and 530 of UGT1A9 (Uniprot ID#O60656)
UGT1A6 Rabbit Polyclonal Antibody
TA309014

USD 625.00

5 Days

Rabbit Polyclonal antibody to UGT1A6 (UDP glucuronosyltransferase 1 family, polypeptide A6)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 8 and 227 of UGT1A6 (Uniprot ID#P19224)
GAA Rabbit Polyclonal Antibody
TA334653

USD 539.00

5 Days

Rabbit Polyclonal Anti-GAA Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-GAA antibody: synthetic peptide directed towards the N terminal of human GAA. Synthetic peptide located within the following region: FGVIVRRQLDGRVLLNTTVAPLFFADQFLQLSTSLPSQYITGLAEHLSPL
beta glucuronidase (GUSB) Rabbit Polyclonal Antibody
TA334656

USD 485.00

5 Days

Rabbit Polyclonal Anti-GUSB Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-GUSB antibody: synthetic peptide directed towards the C terminal of human GUSB. Synthetic peptide located within the following region: VLGNKKGIFTRQRQPKSAAFLLRERYWKIANETRYPHSVAKSQCLENSPF
ENPP1 Goat Polyclonal Antibody
TA336693

USD 550.00

5 Days

Goat Polyclonal ENPP-1 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen A synthetic peptide made to a C-terminal portion of the human ENPP1 protein (between residues 900-925) [UniProt P22413]
GAA (N-term) Rabbit Polyclonal Antibody
AP51752PU-N

USD 580.00

2 Weeks

GAA (N-term) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen conjugated synthetic peptide between 173-203 amino acids from the N-terminal region of Human Alpha-glucosidase