Antibodies

View as table Download

PTPN1 (PTP1B) mouse monoclonal antibody, clone OTI1D10 (formerly 1D10)

Applications FC, IF, IHC, WB
Reactivities Human, Dog, Monkey, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) PTPN1 mouse monoclonal antibody, clone OTI1D10 (formerly 1D10)

Applications FC, IF, IHC, WB
Reactivities Human, Dog, Monkey, Rat
Conjugation Unconjugated

PTPN1 (PTP1B) mouse monoclonal antibody, clone OTI1A2 (formerly 1A2)

Applications FC, IF, WB
Reactivities Human, Rat
Conjugation Unconjugated

Rabbit Polyclonal Anti-G6PC Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-G6PC antibody: synthetic peptide directed towards the N terminal of human G6PC. Synthetic peptide located within the following region: NLVFKWILFGQRPYWWVLDTDYYSNTSVPLIKQFPVTCETGPGSPSGHAM

PTPN1 (PTP1B) mouse monoclonal antibody, clone OTI2G3 (formerly 2G3)

Applications FC, IF, IHC, WB
Reactivities Human, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) PTPN1 mouse monoclonal antibody, clone OTI1A2 (formerly 1A2)

Applications FC, IF, WB
Reactivities Human, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) PTPN1 mouse monoclonal antibody, clone OTI2G3 (formerly 2G3)

Applications FC, IF, IHC, WB
Reactivities Human, Rat
Conjugation Unconjugated

PTPN1 (PTP1B) mouse monoclonal antibody, clone OTI1C5 (formerly 1C5)

Applications IHC, WB
Reactivities Human, Rat
Conjugation Unconjugated

PTPN1 (PTP1B) mouse monoclonal antibody, clone OTI1B4 (formerly 1B4)

Applications FC, WB
Reactivities Human, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) PTPN1 mouse monoclonal antibody, clone OTI1B4 (formerly 1B4)

Applications FC, WB
Reactivities Human, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) PTPN1 mouse monoclonal antibody, clone OTI1C5 (formerly 1C5)

Applications IHC, WB
Reactivities Human, Rat
Conjugation Unconjugated

Rabbit Polyclonal Glut4 Antibody

Applications FC, ICC/IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen A synthetic peptide made to a C-terminal portion of the human Glucose Transporter GLUT4 protein (between residues 480-509) [UniProt P14672]