PTPN1 (PTP1B) mouse monoclonal antibody, clone OTI1D10 (formerly 1D10)
Applications | FC, IF, IHC, WB |
Reactivities | Human, Dog, Monkey, Rat |
Conjugation | Unconjugated |
PTPN1 (PTP1B) mouse monoclonal antibody, clone OTI1D10 (formerly 1D10)
Applications | FC, IF, IHC, WB |
Reactivities | Human, Dog, Monkey, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) PTPN1 mouse monoclonal antibody, clone OTI1D10 (formerly 1D10)
Applications | FC, IF, IHC, WB |
Reactivities | Human, Dog, Monkey, Rat |
Conjugation | Unconjugated |
PTPN1 (PTP1B) mouse monoclonal antibody, clone OTI1A2 (formerly 1A2)
Applications | FC, IF, WB |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
USD 539.00
2 Weeks
Rabbit Polyclonal Anti-G6PC Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-G6PC antibody: synthetic peptide directed towards the N terminal of human G6PC. Synthetic peptide located within the following region: NLVFKWILFGQRPYWWVLDTDYYSNTSVPLIKQFPVTCETGPGSPSGHAM |
PTPN1 (PTP1B) mouse monoclonal antibody, clone OTI2G3 (formerly 2G3)
Applications | FC, IF, IHC, WB |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) PTPN1 mouse monoclonal antibody, clone OTI1A2 (formerly 1A2)
Applications | FC, IF, WB |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) PTPN1 mouse monoclonal antibody, clone OTI2G3 (formerly 2G3)
Applications | FC, IF, IHC, WB |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
USD 471.00
In Stock
G6PC Rabbit monoclonal antibody,clone OTIR4H3
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
USD 471.00
In Stock
G6PC Rabbit monoclonal antibody,clone OTIR5G10
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
USD 471.00
In Stock
G6PC Rabbit monoclonal antibody,clone OTIR2H10
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
PTPN1 (PTP1B) mouse monoclonal antibody, clone OTI1C5 (formerly 1C5)
Applications | IHC, WB |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
PTPN1 (PTP1B) mouse monoclonal antibody, clone OTI1B4 (formerly 1B4)
Applications | FC, WB |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) PTPN1 mouse monoclonal antibody, clone OTI1B4 (formerly 1B4)
Applications | FC, WB |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) PTPN1 mouse monoclonal antibody, clone OTI1C5 (formerly 1C5)
Applications | IHC, WB |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
Rabbit Polyclonal Glut4 Antibody
Applications | FC, ICC/IF, IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide made to a C-terminal portion of the human Glucose Transporter GLUT4 protein (between residues 480-509) [UniProt P14672] |