Antibodies

View as table Download

Rabbit polyclonal Bi-Phospho-ERK1/2(T202/Y204) Antibody

Applications Dot, WB
Reactivities Human (Predicted: Mouse, Rat, Drosophila)
Conjugation Unconjugated
Immunogen This ERK1/2 Antibody is generated from rabbits immunized with a KLH conjugated synthetic phosphopeptide corresponding to amino acid residues surrounding T202/Y204 of human ERK1/2.
Modifications Phospho-specific

Rabbit Polyclonal Smad2/3 (Thr8) Antibody (Phospho-specific)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human Smad2/3 around the phosphorylation site of Threonine 8
Modifications Phospho-specific

Rabbit polyclonal anti-TGF Beta1 antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from human TGF β1 antibody.

Rabbit polyclonal SMAD3-S208 Antibody

Applications FC, IF, IHC, WB
Reactivities Human, Mouse (Predicted: Rat, Chicken, Pig)
Conjugation Unconjugated
Immunogen This SMAD3 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 186-215 amino acids from human SMAD3.

Rabbit Polyclonal Anti-SMAD9 Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human SMAD9

Rabbit Polyclonal Anti-BMP6 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human BMP6

Rabbit Polyclonal Anti-SMAD3 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human SMAD3

Rabbit polyclonal MAPK3 Antibody (N-term)

Applications FC, IHC, WB
Reactivities Human, Mouse, Rat, Monkey
Conjugation Unconjugated
Immunogen This MAPK3 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 1-30 amino acids from the N-terminal region of human MAPK3.

Rabbit polyclonal p44/42 MAPK antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from human ERK1/2.

Anti-SMAD5 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from C terminal 300 amino acids of human SMAD family member 5

Rabbit polyclonal SMAD2 Antibody

Applications FC, IF, WB
Reactivities Human, Mouse (Predicted: Rat, Zebrafish, Bovine, Chicken, Drosophila, Pig)
Conjugation Unconjugated
Immunogen This SMAD2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 97-125 amino acids from human SMAD2.

Rabbit Polyclonal Anti-SMAD6 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SMAD6 antibody: synthetic peptide directed towards the N terminal of human SMAD6. Synthetic peptide located within the following region: APRDASDPLAGAALEPAGGGRSREARSRLLLLEQELKTVTYSLLKR

Rabbit Polyclonal ERK1/2 (Thr202/Tyr204) Antibody (Phospho-specific)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human ERK1/2 around the phosphorylation site of Threonine 202/Tyrosine 204
Modifications Phospho-specific

Rabbit polyclonal antibody to SMAD9 (SMAD family member 9)

Applications IF, WB
Reactivities Human (Predicted: Rhesus Monkey)
Conjugation Unconjugated
Immunogen Recombinant protein fragment contain a sequence corresponding to a region within amino acids 166 and 430 of SMAD9

Rabbit polyclonal Smad1 (Ab-187) antibody

Applications IF, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized non-phosphopeptide derived from human Smad1 around the phosphorylation site of serine 187 (P-H-SP-P-N).