Antibodies

View as table Download

GSTT1 Rabbit Polyclonal Antibody

Applications ICC/IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human GSTT1

GSTA2 (N-term) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen KLH conjugated synthetic peptide between 1~30 amino acids from the N-terminal region of Human GSTA2 / GST2.

Rabbit Polyclonal antibody to GSTA4 (glutathione S-transferase alpha 4)

Applications IHC, WB
Reactivities Human (Predicted: Cow)
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 1 and 222 of GSTA4 (Uniprot ID#O15217)

Rabbit polyclonal antibody to Glutathione peroxidase 7 (glutathione peroxidase 7)

Applications IHC, WB
Reactivities Human (Predicted: Chimpanzee)
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 1 and 187 of GPX7 (Uniprot ID#Q96SL4)

Rabbit Polyclonal antibody to GSTO1 (glutathione S-transferase omega 1)

Applications IHC, WB
Reactivities Human (Predicted: Bovine)
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 30 and 241 of GSTO1 (Uniprot ID#P78417)

Goat Anti-IDH2 Antibody

Applications WB
Reactivities Human, Mouse, Rat (Expected from sequence similarity: Dog, Cow, Pig)
Conjugation Unconjugated
Immunogen Peptide with sequence CIHGLSNVKLNE, from the internal region of the protein sequence according to NP_002159.2.

Rabbit polyclonal GSTT1 Antibody (N-term)

Applications FC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This GSTT1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 7-34 amino acids from the N-terminal region of human GSTT1.

Rabbit anti-IDH1 Polyclonal Antibody

Applications ICC/IF, WB
Reactivities Human, Mouse, Rat, Monkey
Conjugation Unconjugated
Immunogen Recombinant protein of human IDH1

Rabbit anti-GCLM Polyclonal Antibody

Applications ICC/IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human GCLM

Rabbit Polyclonal Anti-GPX3 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-GPX3 antibody: synthetic peptide directed towards the N terminal of human GPX3. Synthetic peptide located within the following region: DCHGGISGTIYEYGALTIDGEEYIPFKQYAGKYVLFVNVASYUGLTGQYI

Rabbit Polyclonal Anti-IDH2 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-IDH2 antibody: synthetic peptide directed towards the middle region of human IDH2. Synthetic peptide located within the following region: GGTVFREPIICKNIPRLVPGWTKPITIGRHAHGDQYKATDFVADRAGTFK

Rabbit Polyclonal Anti-GSTT1 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-GSTT1 antibody: synthetic peptide directed towards the C terminal of human GSTT1. Synthetic peptide located within the following region: TWRQRVEAAVGEDLFQEAHEVILKAKDFPPADPTIKQKLMPWVLAMIR

MGST2 Antibody - N-terminal region

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human MGST2

Rabbit Polyclonal Anti-GCLC Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-GCLC antibody: synthetic peptide directed towards the N terminal of human GCLC. Synthetic peptide located within the following region: VLETLQEKGERTNPNHPTLWRPEYGSYMIEGTPGQPYGGTMSEFNTVEAN

Rabbit Polyclonal Anti-G6PD Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-G6PD antibody: synthetic peptide directed towards the middle region of human G6PD. Synthetic peptide located within the following region: VTKNIHESCMSQIGWNRIIVEKPFGRDLQSSDRLSNHISSLFREDQIYRI