Glutathione S Transferase theta 1 (GSTT1) Rabbit Polyclonal Antibody

CAT#: TA346677

Rabbit Polyclonal Anti-GSTT1 Antibody

Product Images

WB Suggested Anti-GSTT1 Antibody Titration: 0.2-1 ug/ml; Positive Control: Jurkat cell lysate

• 

  Immunohistochemistry with Lung lysate tissue

Specifications

Product Data

• Applications: IHC, WB
• Recommended Dilution: WB, IHC
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-GSTT1 antibody: synthetic peptide directed towards the C terminal of human GSTT1. Synthetic peptide located within the following region: TWRQRVEAAVGEDLFQEAHEVILKAKDFPPADPTIKQKLMPWVLAMIR
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 27 kDa
• Gene Name: glutathione S-transferase theta 1
• Database Link:
  NP_000844
  Entrez Gene 2952 Human
  UniProt ID P30711
• Background: The protein encoded by this gene, glutathione S-transferase (GST) theta 1 (GSTT1), is a member of a superfamily of proteins that catalyze the conjugation of reduced glutathione to a variety of electrophilic and hydrophobic compounds. Human GSTs can be divided into five main classes: alpha, mu, pi, theta, and zeta. The theta class includes GSTT1 and GSTT2. GSTT1 and GSTT2 share 55% amino acid sequence identity and both may play an important role in human carcinogenesis. The GSTT1 and GSTT2 genes have a similar structure, being composed of five exons with identical exon/intron boundaries. This GSTT1 gene is haplotype-specific and is absent from 38% of the population. Alternative splicing of this gene results in multiple transcript variants. Two related pseudogenes, which are also located on chromosome 22, have been identified. [provided by RefSeq, Jun 2014]
• Synonyms: glutathione S-transferase theta 1
• Note: Immunogen Sequence Homology: Human: 100%; Dog: 86%; Rat: 86%; Horse: 86%; Pig: 79%; Bovine: 79%; Rabbit: 79%; Guinea pig: 79%

Reference Data

• Protein Pathways: Drug metabolism - cytochrome P450, Glutathione metabolism, Metabolism of xenobiotics by cytochrome P450