Antibodies

View as table Download

GSTM5 (N-term) rabbit polyclonal antibody, Aff - Purified

Applications FC, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen KLH conjugated synthetic peptide between 21-51 amino acids from the N-terminal region of Human GSTM5

Rabbit Polyclonal antibody to PGD (phosphogluconate dehydrogenase)

Applications IF, IHC, WB
Reactivities Human (Predicted: Mouse, Chicken, Xenopus, Zebrafish, Bovine)
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 1 and 201 of PGD (Uniprot ID#P52209)

Rabbit Polyclonal IDH2 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen IDH2 antibody was raised against a 17 amino acid synthetic peptide near the amino terminus of human IDH2.

Rabbit polyclonal GSTP1 Antibody (C-term)

Applications FC, IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This GSTP1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 165-192 amino acids from the C-terminal region of human GSTP1.

Rabbit polyclonal GSTM1 Antibody (C-term)

Applications FC, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen This GSTM1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 184-211 amino acids from the C-terminal region of human GSTM1.

GSTM1 (1-159) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Bovine, Human, Mouse, Porcine, Rat
Conjugation Unconjugated
Immunogen Recombinant protein fragment containing a sequence corresponding to a region within amino acids 1 and 159 of Human GSTM1

Goat Polyclonal Antibody against GPX1

Applications IHC, WB
Reactivities Human, Pig
Conjugation Unconjugated
Immunogen Peptide with sequence C-REALPAPSDDATA, from the internal region of the protein sequence according to NP_000572.2.

Goat Polyclonal Antibody against GPX4

Applications IHC, WB
Reactivities Human (Expected from sequence similarity: Mouse, Rat, Pig, Cow)
Conjugation Unconjugated
Immunogen Peptide with sequence C-EEPLVIEKDLPHY, from the C Terminus of the protein sequence according to NP_002076.2; NP_001034937.1.

Rabbit Polyclonal antibody to GGT1 (gamma-glutamyltransferase 1)

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 1 and 226 of GGT1 (Uniprot ID#P19440)

Rabbit Polyclonal Glutathione Peroxidase 3 Antibody

Applications ICC/IF, IHC, Immunoblotting, WB
Reactivities Human, Primate, Rat
Conjugation Unconjugated
Immunogen Full length human GPX3 protein [Swiss-Prot# P22352] expressed in E. coli.

Rabbit Polyclonal Anti-GCLM Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-GCLM antibody: synthetic peptide directed towards the middle region of human GCLM. Synthetic peptide located within the following region: KPNSNQVNLASCCVMPPDLTAFAKQFDIQLLTHNDPKELLSEASFQEALQ

Rabbit Polyclonal Anti-GPX4 Antibody - middle region

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-GPX4 antibody: synthetic peptide directed towards the middle region of human GPX4. Synthetic peptide located within the following region: QUGKTEVNYTQLVDLHARYAECGLRILAFPCNQFGKQEPGSNEEIKEFAA

Rabbit Polyclonal Anti-GSTM2 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-GSTM2 antibody: synthetic peptide directed towards the N terminal of human GSTM2. Synthetic peptide located within the following region: TQSNAILRYIARKHNLCGESEKEQIREDILENQFMDSRMQLAKLCYDPDF

Rabbit polyclonal antibody to Glutathione Peroxidase 2 (glutathione peroxidase 2 (gastrointestinal))

Applications IHC, WB
Reactivities Human (Predicted: Dog, Pig, Rabbit, Chimpanzee, Bovine, Rhesus Monkey, X. tropicalis)
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region within amino acids 1 and 54 of GPX2

RRM1 Rabbit Polyclonal Antibody

Applications ICC/IF, IHC, IP, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human RRM1