Rabbit Polyclonal Antibody against TARDBP
| Applications | ELISA, ICC/IF, IHC, WB |
| Reactivities | Human, Primate, Mouse, Xenopus, Zebrafish, Chicken |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide to a C-terminal region [within residues 350-414] of the human TARDBP protein. [Swiss-Prot# Q13148] |
Rabbit polyclonal HDAC9 Antibody (N-term)
| Applications | IF, IHC, IP, WB |
| Reactivities | Human (Predicted: Mouse, Chicken) |
| Conjugation | Unconjugated |
| Immunogen | This HDAC9 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 2-32 amino acids from the N-terminal region of human HDAC9. |
Rabbit Polyclonal antibody to PPP3CB (protein phosphatase 3, catalytic subunit, beta isozyme)
| Applications | IHC, WB |
| Reactivities | Human, Mouse (Predicted: Chicken, Rabbit, Rat, Xenopus, Bovine, X. tropicalis) |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 1 and 228 of PPP3CB (Uniprot ID#P16298) |
Rabbit polyclonal SMAD3-S208 Antibody
| Applications | FC, IF, IHC, WB |
| Reactivities | Human, Mouse (Predicted: Rat, Chicken, Pig) |
| Conjugation | Unconjugated |
| Immunogen | This SMAD3 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 186-215 amino acids from human SMAD3. |
Rabbit polyclonal anti-TBP antibody, Loading control
| Applications | FC, IF, IHC, WB |
| Reactivities | Human (Predicted: Mouse, Zebrafish, Bovine, Chicken, Monkey, Xenopus) |
| Conjugation | Unconjugated |
| Immunogen | This TBP antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 210-239 amino acids from the Central region of human TBP. |
Rabbit polyclonal HDAC2 Antibody (Center)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human (Predicted: Mouse, Chicken) |
| Conjugation | Unconjugated |
| Immunogen | This HDAC2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 410-439 amino acids from the Central region of human HDAC2. |
Rabbit polyclonal ENO1 Antibody (Center)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human, Mouse (Predicted: Rat, Bovine, Chicken, Monkey, Xenopus) |
| Conjugation | Unconjugated |
| Immunogen | This ENO1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 178-205 amino acids from the Central region of human ENO1. |
Rabbit polyclonal FOXG1 Antibody (Center)
| Applications | FC, IF, WB |
| Reactivities | Human, Mouse (Predicted: Rat, Chicken, Drosophila, Xenopus) |
| Conjugation | Unconjugated |
| Immunogen | This FOXG1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 225-252 amino acids from the Central region of human FOXG1. |
Rabbit polyclonal antibody to ERG (v-ets erythroblastosis virus E26 oncogene homolog (avian))
| Applications | IF, WB |
| Reactivities | Human (Predicted: Rat, Pig, Chicken, X. tropicalis) |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region within amino acids 419 and 486 of ERG (Uniprot ID#P11308) |
Rabbit polyclonal TARDBP Antibody (N-term)
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse (Predicted: Chicken) |
| Conjugation | Unconjugated |
| Immunogen | This TARDBP antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 1-30 amino acids from the N-terminal region of human TARDBP. |
Rabbit Polyclonal Anti-HIF1A Antibody
| Applications | WB |
| Reactivities | Human, Chicken, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-HIF1A antibody: synthetic peptide directed towards the middle region of human HIF1A. Synthetic peptide located within the following region: VKGCKSSEQNGMEQKTIILIPSDLACRLLGQSMDESGLPQLTSYDCEVNA |
Rabbit Polyclonal antibody to Flightless I (flightless I homolog (Drosophila))
| Applications | IF, WB |
| Reactivities | Human, Mouse (Predicted: Chicken, Rat, X. tropicalis) |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 435 and 778 of Flightless I (Uniprot ID#Q13045) |
Rabbit polyclonal JUN Antibody (C-term)
| Applications | FC, IHC, WB |
| Reactivities | Human (Predicted: Mouse, Rat, Bovine, Chicken, Pig) |
| Conjugation | Unconjugated |
| Immunogen | This JUN antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 222-251 amino acids from the C-terminal region of human JUN. |
Rabbit polyclonal antibody to PSMC3 (proteasome (prosome, macropain) 26S subunit, ATPase, 3)
| Applications | IF, IHC, WB |
| Reactivities | Human (Predicted: Zebrafish, Chicken, Bovine, Rhesus Monkey, X. tropicalis, Mouse) |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 51 and 361 of PSMC3 (Uniprot ID#P17980) |
Rabbit polyclonal CAF-1 Antibody (N-term)
| Applications | IF, IHC, WB |
| Reactivities | Human (Predicted: Mouse, Zebrafish, Bovine, Chicken, Xenopus) |
| Conjugation | Unconjugated |
| Immunogen | This CAF-1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 34-61 amino acids from the N-terminal region of human CAF-1. |
Germany
Japan
United Kingdom
China
