Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit Polyclonal DEC1 Antibody
| Applications | ChIP, ELISA, FC, ICC/IF, IHC, Immunoblotting, IP, Simple Western, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This DEC1 antibody maps to a region between residues 350 and the C-terminus (residue 412) of human Differentially Expressed in Chondrocytes NP_003661.1 (GeneID 8553). |
Rabbit Polyclonal Anti-BHLHB2 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-BHLHB2 antibody: synthetic peptide directed towards the middle region of human BHLHB2. Synthetic peptide located within the following region: SEKGDLRSEQPCFKSDHGRRFTMGERIGAIKQESEEPPTKKNRMQLSDDE |
Rabbit Polyclonal Anti-PER2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PER2 antibody: synthetic peptide directed towards the middle region of human PER2. Synthetic peptide located within the following region: VAECVYCENKEKGNICIPYEEDIPSLGLSEVSDTKEDENGSPLNHRIEEQ |
Rabbit polyclonal antibody to SHARP2 (basic helix-loop-helix domain containing, class B, 2)
| Applications | IF, WB |
| Reactivities | Human (Predicted: Mouse, Rat, Bovine) |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region within amino acids 1 and 81 of SHARP2 (Uniprot ID#O14503) |
Rabbit Polyclonal Anti-ARNTL Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ARNTL antibody: synthetic peptide directed towards the N terminal of human ARNTL. Synthetic peptide located within the following region: TDYQESMDTDKDDPHGRLEYTEHQGRIKNAREAHSQIEKRRRDKMNSF |
Rabbit Polyclonal Anti-ARNTL Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human ARNTL |
Rabbit Polyclonal Anti-CLOCK Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CLOCK antibody: synthetic peptide directed towards the N terminal of human CLOCK. Synthetic peptide located within the following region: LFTVSCSKMSSIVDRDDSSIFDGLVEEDDKDKAKRVSRNKSEKKRRDQFN |
Goat Anti-BMAL1 / ARNTL Antibody
| Applications | WB |
| Reactivities | Human (Expected from sequence similarity: Mouse, Rat, Dog, Pig, Cow) |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence REKITTNCYKFKIKD, from the internal region of the protein sequence according to NP_001169.3; NP_001025444.1. |
Rabbit anti-CLOCK polyclonal antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide conjugated to KLH |
Rabbit polyclonal anti-PER3 antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human PER3. |
Rabbit Polyclonal Anti-BHLHB3 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-BHLHB3 Antibody: synthetic peptide directed towards the middle region of human BHLHB3. Synthetic peptide located within the following region: YCVPVIQRTQPSAELAAENDTDTDSGYGGEAEARPDREKGKGAGASRVTI |
Rabbit Polyclonal Anti-NR1D1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-NR1D1 antibody: synthetic peptide directed towards the N terminal of human NR1D1. Synthetic peptide located within the following region: NGSFQSLTQGCPTYFPPSPTGSLTQDPARSFGSIPPSLSDDGSPSSSSSS |
Active filters
Applications
- WB
Isotypes
- IgG
Clonalities
- Polyclonal
Families
- Transcription Factors
Pathways
- Circadian rhythm - mammal