SHARP1 (BHLHE41) Rabbit Polyclonal Antibody

CAT#: TA333644

Rabbit Polyclonal Anti-BHLHB3 Antibody

Product Images

WB Suggested Anti-BHLHB3 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:312500; Positive Control: HepG2 cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-BHLHB3 Antibody: synthetic peptide directed towards the middle region of human BHLHB3. Synthetic peptide located within the following region: YCVPVIQRTQPSAELAAENDTDTDSGYGGEAEARPDREKGKGAGASRVTI
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 50 kDa
• Gene Name: basic helix-loop-helix family member e41
• Database Link:
  NP_110389
  Entrez Gene 79365 Human
  UniProt ID Q9C0J9
• Background: BHLHB3 may be a transcriptional repressor that represses both basal and activated transcription. It play a role as a tumor suppressor for lung cancer. DEC1 and DEC2(BHLHB3) may play a crucial role in the adaptation to hypoxia and are regulators of the mammalian molecular clock, and form a fifth clock-gene family.
• Synonyms: BHLHB3; DEC2; hDEC2; SHARP1
• Note: Immunogen sequence homology: Dog: 100%; Pig: 100%; Human: 100%; Bovine: 87%

Reference Data

• Protein Families: Transcription Factors
• Protein Pathways: Circadian rhythm - mammal