SHARP1 (BHLHE41) Rabbit Polyclonal Antibody
Frequently bought together (2)
Transient overexpression lysate of basic helix-loop-helix family, member e41 (BHLHE41)
USD 436.00
beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
USD 200.00
Other products for "SHARP1"
Specifications
Product Data | |
Applications | WB |
Recommended Dilution | WB |
Reactivities | Human |
Host | Rabbit |
Isotype | IgG |
Clonality | Polyclonal |
Immunogen | The immunogen for Anti-BHLHB3 Antibody: synthetic peptide directed towards the middle region of human BHLHB3. Synthetic peptide located within the following region: YCVPVIQRTQPSAELAAENDTDTDSGYGGEAEARPDREKGKGAGASRVTI |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Purification | Affinity Purified |
Conjugation | Unconjugated |
Storage | Store at -20°C as received. |
Stability | Stable for 12 months from date of receipt. |
Predicted Protein Size | 50 kDa |
Gene Name | basic helix-loop-helix family member e41 |
Database Link | |
Background | BHLHB3 may be a transcriptional repressor that represses both basal and activated transcription. It play a role as a tumor suppressor for lung cancer. DEC1 and DEC2(BHLHB3) may play a crucial role in the adaptation to hypoxia and are regulators of the mammalian molecular clock, and form a fifth clock-gene family. |
Synonyms | BHLHB3; DEC2; hDEC2; SHARP1 |
Note | Immunogen sequence homology: Dog: 100%; Pig: 100%; Human: 100%; Bovine: 87% |
Reference Data | |
Protein Families | Transcription Factors |
Protein Pathways | Circadian rhythm - mammal |
Documents
Product Manuals |
FAQs |
SDS |
{0} Product Review(s)
0 Product Review(s)
Submit review
Be the first one to submit a review
Product Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.