Goat Polyclonal Antibody against PTF1A
| Applications | WB |
| Reactivities | Human, Mouse (Expected from sequence similarity: Rat, Dog, Zebrafish) |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-WTDEKQLKEQN, from the internal region of the protein sequence according to NP_835455.1. |
Rabbit Polyclonal Anti-Ptf1a Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Ptf1a antibody is: synthetic peptide directed towards the N-terminal region of Mouse Ptf1a. Synthetic peptide located within the following region: FPSPYFDEEDFFTDQSSRDPLEDSDELLGDEQAEVEFLSHQLHEYCYRDG |
Germany
Japan
United Kingdom
China