Rabbit polyclonal anti-TUBB(beta Tubulin) antibody, Loading control
| Applications | ICC/IF, IHC, Simple Western, WB |
| Reactivities | Human, Mouse, Chicken, Xenopus, Porcine, Zebrafish, Hamster, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide made to the N-terminal region of human beta tubulin (within residues 1-100). Swiss-Prot P07437. |
Rabbit Polyclonal Ki-67/MKI67 Antibody
| Applications | FC, ICC/IF, IHC, Immunoblotting, IP, WB |
| Reactivities | Human, Mouse, Rat, Porcine |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide made to an internal region of human Ki67 (within residues 1550-1700) [Swiss-Prot# P46013] |
Rabbit Polyclonal Antibody against ATG5
| Applications | Electron Microscopy, ELISA, FC, ICC/IF, IHC, Immunoblotting, IP, Simple Western, WB |
| Reactivities | Human, Mouse, Porcine, Primate, Xenopus, Zebrafish, Cow, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide made to an N-terminal region (within residues 1-50) of the human ATG5 protein. [Swiss-Prot# Q9H1Y0] |
Rabbit Polyclonal Antibody against UCHL1 (PGP9.5) - Neuronal Marker - Neuronal Marker
| Applications | FC, ICC/IF, IHC, Simple Western, WB |
| Reactivities | Human, Mouse, Monkey, Rat, Porcine, Horse |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide made to a C-terminal portion of the human UCHL1 protein (between residues 200-223). [UniProt# P09936] |
Rabbit Polyclonal Perilipin Antibody
| Applications | FC, ICC/IF, IHC, WB |
| Reactivities | Bovine, Human, Mouse, Porcine, Rat, Sheep |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide made to a region between residues 450-522 (C-terminus) of the human perilipin protein. [Swiss-Prot# O60240] |
Rabbit Polyclonal MUC-1 Antibody
| Applications | FC, ICC/IF, IHC, WB |
| Reactivities | Human, Mouse, Rat, Bovine, Equine, Guinea Pig, Porcine |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptides corresponding to MUC1(mucin 1, cell surface associated) The peptide sequence was selected from the C terminal region between aa 1200-1250 of human MUC1 (NP_001037855). Peptide sequence GQLDIFPARDTYHPMSEYPTYHTHGRYVPPSSTDRSPYEKVSAGNGGSSL. |
Rabbit Polyclonal Beclin 1/ATG6 Antibody
| Applications | ICC/IF, IHC, Simple Western, WB |
| Reactivities | Human, Mouse, Canine, Porcine, Primate |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide made to an internal portion of human Beclin 1 (within residues 150-300). [Swiss-Prot# Q14457] |
Rabbit Polyclonal Antibody against LOX
| Applications | ICC/IF, IHC, Simple Western, WB |
| Reactivities | Human, Mouse, Rat, Porcine, Cow |
| Conjugation | Unconjugated |
| Immunogen | A cocktail of two synthetic peptides; one made to a region of the human LOX protein within residues 300-400 and one within residues 200-300 |
Rabbit Polyclonal Niemann-Pick C1 Antibody
| Applications | Electron Microscopy, ICC/IF, IHC, IP, WB |
| Reactivities | Human, Mouse, Rat, Porcine, Hamster, Primate |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide made to the C-terminal region of human Niemann-Pick C. [UniProt# O15118] |
Mu Opioid Receptor (OPRM1) (Center) rabbit polyclonal antibody, Aff - Purified
| Applications | FC, IHC, WB |
| Reactivities | Human, Monkey, Mouse, Porcine, Rat |
| Conjugation | Unconjugated |
| Immunogen | KLH conjugated synthetic peptide between 161-187 amino acids from the Center region of human OPRM1 |
Rabbit Polyclonal Pyruvate Carboxylase Antibody
| Applications | ICC/IF, IHC, WB |
| Reactivities | Bovine, Human, Mouse, Porcine, Rat |
| Conjugation | Unconjugated |
| Immunogen | A genomic peptide made to an internal region of the human Pyruvate Carboxylase protein (within residues 930-1050). [Swiss-Prot P11498] |
Annexin A1 (ANXA1) (324-337) goat polyclonal antibody, Aff - Purified
| Applications | ELISA, IHC, WB |
| Reactivities | Bovine, Canine, Human, Mouse, Porcine, Rat, Bat, Equine, Guinea Pig, Hamster, Monkey, Rabbit |
| Conjugation | Unconjugated |
| Immunogen | Peptide from the C Terminus of the protein sequence according to NP_000691.1 |
TLR3 (514-657) rabbit polyclonal antibody, Aff - Purified
| Applications | IF, IHC, WB |
| Reactivities | Bovine, Feline, Guinea Pig, Human, Monkey, Mouse, Porcine, Rabbit, Rat |
| Conjugation | Unconjugated |
| Immunogen | TLR3 antibody was raised against recombinant protein fragment containing a sequence corresponding to a region within amino acids 514 and 657 of TLR3. |
Rabbit Polyclonal LOX propeptide Antibody
| Applications | ICC/IF, IHC, Immunoblotting, WB |
| Reactivities | Human, Mouse, Rat, Porcine, Primate |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide made to an internal region of mouse LOX propeptide (residues 78-115). [UniProt# P28301] |
Germany
Japan
United Kingdom
China
