Antibodies

View as table Download

HES1 mouse monoclonal antibody, clone OTI2D2 (formerly 2D2)

Applications FC, IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Anti-Notch1 mouse monoclonal antibody, clone OTI3E12 (formerly 3E12)

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Anti-HES1 mouse monoclonal antibody, clone OTI4H1 (formerly 4H1)

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) Notch1 mouse monoclonal antibody, clone OTI3E12 (formerly 3E12)

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Anti-Notch1 mouse monoclonal antibody, clone OTI3E12 (formerly 3E12)

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Special Offer: Get this product for $99/€99. Use code: "Truesample".

Anti-HES1 mouse mAb, clone OTI4H1, HRP conjugated

Applications WB
Reactivities Human
Conjugation HRP

Carrier-free (BSA/glycerol-free) HES5 mouse monoclonal antibody,clone OTI6F7

Applications WB
Reactivities Human
Conjugation Unconjugated

DLL4 rabbit polyclonal antibody, Purified

Applications ELISA, IHC, WB
Reactivities Human, Monkey, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to the internal region of human DLL4.

Rabbit Polyclonal Anti-DVL1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-DVL1 antibody: synthetic peptide directed towards the middle region of human DVL1. Synthetic peptide located within the following region: LKITIANAVIGADVVDWLYTHVEGFKERREARKYASSLLKHGFLRHTVNK

NOTCH1 rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a sequence at the middle region of human NOTCH1