Antibodies

Jump to Filters
View as table Download
IFIT5 Rabbit Polyclonal Antibody
TA334459

USD 539.00

5 Days

Rabbit Polyclonal Anti-IFIT5 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-IFIT5 antibody: synthetic peptide directed towards the middle region of human IFIT5. Synthetic peptide located within the following region: ITVYRLDDSDREGSVKSFSLGPLRKAVTLNPDNSYIKVFLALKLQDVHAE
IFIT5 Rabbit Polyclonal Antibody
TA334458

USD 539.00

5 Days

Rabbit Polyclonal Anti-IFIT5 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-IFIT5 antibody: synthetic peptide directed towards the N terminal of human IFIT5. Synthetic peptide located within the following region: LEEAQKYTGKIGNVCKKLSSPSNYKLECPETDCEKGWALLKFGGKYYQKA