Rabbit Polyclonal TLR2 Antibody
Applications | ELISA, IF, IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | TLR2 antibody was raised against a peptide corresponding to 14 amino acids near the amino terminus of human TLR2. |
Rabbit Polyclonal TLR2 Antibody
Applications | ELISA, IF, IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | TLR2 antibody was raised against a peptide corresponding to 14 amino acids near the amino terminus of human TLR2. |
Rabbit Polyclonal anti-TLR2 antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-TLR2 antibody: synthetic peptide directed towards the C terminal of human TLR2. Synthetic peptide located within the following region: LEPIEKKAIPQRFCKLRKIMNTKTYLEWPMDEAQREGFWVNLRAAIKS |
Rabbit Polyclonal Anti-TLR2 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human TLR2 |
Mouse Monoclonal TLR2 Antibody (TL2.1)
Applications | Block/Neutralize, Dot, ELISA, FC, ICC/IF, IP, WB |
Reactivities | Human, Canine |
Conjugation | Unconjugated |
Toll-Like Receptor 2 Rabbit monoclonal Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Rabbit Polyclonal TLR2 Antibody
Applications | FC, ICC/IF, IHC, IP, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | This antibody was developed against a mixture of synthetic peptides containing amino acids 180-196, 353-370, and 473-489 of human TLR2 (NP_003255). |
Tlr2 (C-term) rabbit polyclonal antibody, Purified
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | This antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide selected from the C-terminal region of mouse TLR2. |
TLR2 rabbit polyclonal antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human TLR2 |
TLR2 Rabbit polyclonal Antibody
Applications | ICC/IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 19-300 of human TLR2 (NP_003255.2). |
Modifications | Unmodified |
Rat Monoclonal TLR2 Antibody (11G5)
Applications | CyTOF-ready, FC, WB |
Reactivities | Mouse |
Conjugation | Unconjugated |
TLR2 rabbit polyclonal antibody
Applications | IHC, WB |
Conjugation | Unconjugated |
TLR2 mouse monoclonal antibody, clone TL2.1, Biotin
Applications | FC, IF, IHC, WB |
Reactivities | Canine, Human, Monkey |
Conjugation | Biotin |
Goat Polyclonal Anti-TLR2 Antibody
Applications | WB |
Reactivities | Canine, Human, Monkey, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Purified recombinant peptide derived from within residues 736 aa to the C-terminus of human TLR2 produced in E. coli. |
TLR2 mouse monoclonal antibody, clone TL2.3, Purified
Applications | ELISA, FC, FN, IF, IHC, WB |
Reactivities | Canine, Human |
Conjugation | Unconjugated |
Rabbit Polyclonal TLR2 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | This antibody was developed against an extracellular domain of mouse TLR2 (amino acids 564-580 and 751-770). |