Germany
Japan
United Kingdom
China
Antibodies
View as table Download
USD 509.00
2 Weeks
USD 509.00
2 Weeks
Anti-FOSL1 (FRA1) mouse monoclonal antibody, clone OTI12F9 (formerly 12F9)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
Rabbit Polyclonal anti-FOSL1 antibody
| Applications | IHC, WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-FOSL1 antibody: synthetic peptide directed towards the middle region of human FOSL1. Synthetic peptide located within the following region: TDFLQAETDKLEDEKSGLQREIEELQKQKERLELVLEAHRPICKIPEGAK |
Rabbit polyclonal Fra-1 antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human Fra-1. |
Goat Polyclonal Antibody against FRA1 / FOSL1
| Applications | WB |
| Reactivities | Human (Expected from sequence similarity: Mouse, Rat, Dog, Pig, Cow) |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-QREIEELQKQKER, from the internal region of the protein sequence according to NP_005429.1. |
Rabbit Polyclonal anti-FOSL1 antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-FOSL1 antibody: synthetic peptide directed towards the middle region of human FOSL1. Synthetic peptide located within the following region: EKSGLQREIEELQKQKERLELVLEAHRPICKIPEGAKEGDTGSTSGTSSP |
Active filters
Category
- Antibodies
Target Symbol
- FRA1
Applications
- WB
Families
- Druggable Genome
Pathways
- Wnt signaling pathway