Rabbit Polyclonal Calnexin Antibody
| Applications | FC, ICC/IF, IHC, IP, Simple Western, WB |
| Reactivities | Human, Mouse, Rat, Bovine, Chicken, Avian, Drosophila |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide made to an internal region of the canine Calnexin protein (within residues 25-100). [Swiss-Prot P24643] |
Rabbit Polyclonal antibody to alpha Tubulin 1A (tubulin, alpha 1a)
| Applications | IF, IHC, WB |
| Reactivities | Human, Drosophila, Rat, Mouse (Predicted: Chimpanzee, Bovine, Rhesus Monkey) |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein fragment contain a sequence corresponding to a region within amino acids 37 and 276 of alpha Tubulin 1A |
Rabbit polyclonal Bi-Phospho-ERK1/2(T202/Y204) Antibody
| Applications | Dot, WB |
| Reactivities | Human (Predicted: Mouse, Rat, Drosophila) |
| Conjugation | Unconjugated |
| Immunogen | This ERK1/2 Antibody is generated from rabbits immunized with a KLH conjugated synthetic phosphopeptide corresponding to amino acid residues surrounding T202/Y204 of human ERK1/2. |
| Modifications | Phospho-specific |
Rabbit polyclonal FOXG1 Antibody (Center)
| Applications | FC, IF, WB |
| Reactivities | Human, Mouse (Predicted: Rat, Chicken, Drosophila, Xenopus) |
| Conjugation | Unconjugated |
| Immunogen | This FOXG1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 225-252 amino acids from the Central region of human FOXG1. |
Rabbit polyclonal ATP6V1B1 Antibody (Center)
| Applications | IF, IHC, WB |
| Reactivities | Human (Predicted: Mouse, Rat, Bovine, Chicken, Drosophila, C. elegans) |
| Conjugation | Unconjugated |
| Immunogen | This ATP6V1B1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 284-310 amino acids from the Central region of human ATP6V1B1. |
Rabbit polyclonal SMAD2 Antibody
| Applications | FC, IF, WB |
| Reactivities | Human, Mouse (Predicted: Rat, Zebrafish, Bovine, Chicken, Drosophila, Pig) |
| Conjugation | Unconjugated |
| Immunogen | This SMAD2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 97-125 amino acids from human SMAD2. |
FH (176-189) goat polyclonal antibody, Aff - Purified
| Applications | ELISA, IHC, WB |
| Reactivities | Canine, Human, Mouse, Rat, Bovine, Chicken, Drosophila, Equine, Hamster, Insect, Monkey, Porcine, Sheep, Xenopus, Zebrafish |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide from an internal region of human FH |
Rabbit Polyclonal Antibody against RAC1 (S71)
| Applications | WB |
| Reactivities | Human (Predicted: Mouse, Rat, Bovine, Chicken, Drosophila, Pig, Monkey, C. elegans) |
| Conjugation | Unconjugated |
| Immunogen | This RAC1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 49-78 amino acids from human RAC1. |
Rabbit Polyclonal anti-CALR Antibody
| Applications | IF, WB |
| Reactivities | Human, Mouse, Rat, Bovine, Dog, Chicken, Drosophila, Fish, Monkey, Porcine, Rabbit, Sheep, Hamster, Guinea Pig |
| Conjugation | Unconjugated |
| Immunogen | Human calreticulin synthetic peptide with a cysteine residue added and the peptide conjugated to KLH |
Rabbit Polyclonal Antibody against CDC2 (T14)
| Applications | IHC, WB |
| Reactivities | Human (Predicted: Mouse, Rat, Bovine, Chicken, Drosophila, Xenopus) |
| Conjugation | Unconjugated |
| Immunogen | This CDK1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 1-30 amino acids from human CDK1. |
Rabbit Polyclonal Anti-TUBE1 Antibody - middle region
| Applications | IHC, WB |
| Reactivities | Drosophila, Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TUBE1 antibody: synthetic peptide directed towards the middle region of human TUBE1. Synthetic peptide located within the following region: HLHHYLQVEGMEESCFTEAVSSLSALIQEYDQLDATKNMPVQDLPRLSIA |
GRP94 (HSP90B1) rabbit polyclonal antibody, Aff - Purified
| Applications | ELISA, IHC, WB |
| Reactivities | Chicken, Drosophila, Human, Monkey, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide. |
Rabbit polyclonal Hsp 90 alpha antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat, Monkey, Chicken, Drosophila |
| Conjugation | Unconjugated |
| Immunogen | This affinity purified antibody was prepared from whole rabbit serum produced by repeated immunizations with a synthetic peptide corresponding to amino acids 289-300 of human Hsp90 protein. |
Rabbit Polyclonal Antibody against MAP2K1 (S217)
| Applications | WB |
| Reactivities | Human (Predicted: Mouse, Rat, Chicken, Drosophila, Hamster, Rabbit, Xenopus) |
| Conjugation | Unconjugated |
| Immunogen | This MEK1(MAP2K1) antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 196-225 amino acids from human MEK1(MAP2K1). |
Germany
Japan
United Kingdom
China
