HSPD1 mouse monoclonal antibody,clone OTI3A2
Applications | IHC, WB |
Reactivities | Human, Dog, Monkey, Mouse, Rat |
Conjugation | Unconjugated |
HSPD1 mouse monoclonal antibody,clone OTI3A2
Applications | IHC, WB |
Reactivities | Human, Dog, Monkey, Mouse, Rat |
Conjugation | Unconjugated |
HSPD1 mouse monoclonal antibody,clone OTI4E4
Applications | IHC, WB |
Reactivities | Human, Mouse, Monkey, Dog, Rat |
Conjugation | Unconjugated |
DCPS mouse monoclonal antibody,clone OTI1E6
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
HSPD1 mouse monoclonal antibody,clone OTI4E4
Applications | IHC, WB |
Reactivities | Human, Mouse, Monkey, Dog, Rat |
Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
LSM1 mouse monoclonal antibody, clone OTI5E6 (formerly 5E6)
Applications | FC, IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Rabbit Anti-NSE (Neuron specific enolase) Antibody
Applications | IF, WB |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant human NSE expressed in and purified from E. coli |
Rabbit Polyclonal Anti-RQCD1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-RQCD1 antibody is: synthetic peptide directed towards the middle region of Human RQCD1. Synthetic peptide located within the following region: SLGVIGALVKTDEQEVINFLLTTEIIPLCLRIMESGSELSKTVATFILQK |