Antibodies

Jump to Filters
View as table Download
NMDAR1 (GRIN1) Rabbit Polyclonal Antibody
TA323549

USD 380.00

4 Weeks

Anti-GRIN1 Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 35-49 amino acids of human glutamate receptor, ionotropic, N-methyl D-aspartate 1
NMDAR1 (GRIN1) Rabbit Polyclonal Antibody
TA323550

USD 380.00

In Stock

Anti-GRIN1 Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 35-49 amino acids of human glutamate receptor, ionotropic, N-methyl D-aspartate 1
Glutamate receptor ionotropic, NMDA 2D (GRIN2D) Rabbit Polyclonal Antibody
TA323555

USD 380.00

4 Weeks

Anti-GRIN2D Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 1264-1278 amino acids of Human glutamate receptor, ionotropic, N-methyl D-aspartate 2D
NMDAR1 (GRIN1) Rabbit Polyclonal Antibody
AP21091PU-N

USD 465.00

3 Weeks

NMDAR1 (GRIN1) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide, corresponding to amino acids 860-910 of Human NMDAζ1.
NMDAR2A (GRIN2A) Rabbit Polyclonal Antibody
TA350718

USD 380.00

In Stock

Rabbit Polyclonal Anti-GRIN2A Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human GRIN2A
NMDAR1 (GRIN1) Rabbit Polyclonal Antibody
AP20758PU-N

USD 465.00

3 Weeks

NMDAR1 (GRIN1) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
NMDAR1 (GRIN1) (N-term) Rabbit Polyclonal Antibody
AP23337PU-N

USD 560.00

2 Weeks

NMDAR1 (GRIN1) (N-term) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide corresponding to a sequence at the N-terminal of human NMDAR1
NMDAR2A (GRIN2A) Rabbit Polyclonal Antibody
TA338510

USD 539.00

5 Days

Rabbit Polyclonal Anti-GRIN2A Antibody

Applications IHC, WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-GRIN2A antibody: synthetic peptide directed towards the middle region of human GRIN2A. Synthetic peptide located within the following region: DKIYTIDGEKEPGFHLDPPQFVENVTLPENVDFPDPYQDPSENFRKGDST
NMDAR1 (GRIN1) Rabbit Polyclonal Antibody
TA318695

USD 500.00

In Stock

NMDAR1 / NR1 Rabbit Polyclonal (C-Terminus) Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen GRIN1 / NMDAR1 antibody was raised against synthetic peptide from human NMDAR1 (aa864-913).
NMDAR1 (GRIN1) pSer897 Rabbit Polyclonal Antibody
AP20959PU-N

USD 445.00

3 Weeks

NMDAR1 (GRIN1) pSer897 rabbit polyclonal antibody, Aff - Purified

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
NMDAR1 (GRIN1) pSer896 Rabbit Polyclonal Antibody
AP20960PU-N

USD 495.00

3 Weeks

NMDAR1 (GRIN1) pSer896 rabbit polyclonal antibody, Aff - Purified

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic phosphopeptide derived from Human NMDAζ1 around the phosphorylation site of Serine 896
NMDAR1 (GRIN1) Rabbit Polyclonal Antibody
AP21047PU-N

USD 465.00

3 Weeks

NMDAR1 (GRIN1) rabbit polyclonal antibody, Aff - Purified

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
NMDAR1 (GRIN1) Rabbit Polyclonal Antibody
TA326171

USD 380.00

In Stock

Rabbit polyclonal NMDAR1 (Phospho-Ser890) antibody

Applications IF, IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from human NMDAR1 around the phosphorylation site of serine 890 (A-S-SP-F-K).
Modifications Phospho-specific