Rabbit Polyclonal anti-HSPA9 antibody
| Applications | IHC, IP, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-HSPA9 antibody: synthetic peptide directed towards the C terminal of human HSPA9. Synthetic peptide located within the following region: GENIRQAASSLQQASLKLFEMAYKKMASEREGSGSSGTGEQKEDQKEEKQ |
Rabbit polyclonal ENO1 Antibody (Center)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human, Mouse (Predicted: Rat, Bovine, Chicken, Monkey, Xenopus) |
| Conjugation | Unconjugated |
| Immunogen | This ENO1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 178-205 amino acids from the Central region of human ENO1. |
Rabbit Polyclonal antibody to PNPase (polyribonucleotide nucleotidyltransferase 1)
| Applications | IHC, WB |
| Reactivities | Human, Mouse (Predicted: Rat, Cow) |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment contain a sequence corresponding to a region within amino acids 25 and 251 of PNPase (Uniprot ID#Q8TCS8) |
Rabbit polyclonal HSPD1 Antibody (C-term)
| Applications | FC, IHC, WB |
| Reactivities | Human, Mouse (Predicted: Rat, Bovine, Chicken, Hamster) |
| Conjugation | Unconjugated |
| Immunogen | This HSPD1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 396-423 amino acids from the C-terminal region of human HSPD1. |
Germany
Japan
United Kingdom
China
