Anti-TRPV4 Rabbit Polyclonal Antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to a region derived from 237-465 amino acids of human transient receptor potential cation channel, subfamily V, member 4 |
Rabbit Polyclonal Anti-TRPA1 Antibody
| Applications | IHC, WB |
| Reactivities | Rat, Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TRPA1 antibody: synthetic peptide directed towards the middle region of human TRPA1. Synthetic peptide located within the following region: KCTDRLDEDGNTALHFAAREGHAKAVALLLSHNADIVLNKQQASFLHLAL |
Anti-TRPM1 Rabbit Polyclonal Antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 806-820 amino acids of human transient receptor potential cation channel, subfamily M, member 1 |
Anti-TRPC3 Rabbit Polyclonal Antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 823-836 amino acids of human transient receptor potential cation channel, subfamily C, member 3 |
Anti-TRPM7 Rabbit Polyclonal Antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 1850-1863 amino acids of human transient receptor potential cation channel, subfamily M, member 7 |
Anti-TRPM7 Rabbit Polyclonal Antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 1850-1863 amino acids of human transient receptor potential cation channel, subfamily M, member 7 |
Anti-TRPV4 Rabbit Polyclonal Antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to a region derived from 237-465 amino acids of human transient receptor potential cation channel, subfamily V, member 4 |
Anti-TRPC3 Rabbit Polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 834-846 amino acids of human transient receptor potential cation channel, subfamily C, member 3 |
Rabbit polyclonal antibody to TRPM2 (transient receptor potential cation channel, subfamily M, member 2)
| Applications | IHC, WB |
| Reactivities | Human (Predicted: Mouse, Rat) |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 181 and 423 of TRPM2 (Uniprot ID#O94759) |
Rabbit Polyclonal Anti-TRPV4 Antibody
| Applications | IHC, WB |
| Reactivities | Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TRPV4 antibody: synthetic peptide directed towards the middle region of human TRPV4. Synthetic peptide located within the following region: RVDEVNWSHWNQNLGIINEDPGKNETYQYYGFSHTVGRLRRDRWSSVVPR |
TRPV4 Rabbit Polyclonal (Internal) Antibody
| Applications | IHC |
| Reactivities | Bovine, Dog, Gorilla, Human, Monkey, Mouse, Pig, Rat, Gibbon, Hamster, Horse (Predicted: Rabbit, Chicken) |
| Conjugation | Unconjugated |
| Immunogen | TRPV4 antibody was raised against synthetic 20 amino acid peptide from internal region of human TRPV4. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Marmoset, Mouse, Rat, Hamster, Panda, Bovine, Dog, Horse, Pig (100%); Elephant, Rabbit (95%); Turkey, Chicken, Platypus (90%); Xenopus (85%); Stickleback, Zebrafish (80%). |
Germany
Japan
United Kingdom
China
