Antibodies

Jump to Filters
View as table Download
SOX9 Rabbit Polyclonal Antibody
TA337025

USD 550.00

2 Weeks

Rabbit Polyclonal SOX9 Antibody

Applications IHC, Simple Western, WB
Reactivities Human, Mouse, Rat, Canine, Feline, Goat, Primate
Conjugation Unconjugated
Immunogen A portion of amino acids 225-275 of human SOX9 was used as the immunogen for this antibody.
Luteinizing Hormone beta (LHB) Rabbit Polyclonal Antibody
AP02115SU-S

USD 175.00

2 Weeks

Luteinizing Hormone beta (LHB) rabbit polyclonal antibody, Serum

Applications ELISA, IHC, R, WB
Reactivities Bovine, Deer, Goat, Human, Sheep
Conjugation Unconjugated
Immunogen Bovine Luteinizing Hormone
CRLR (CALCRL) Rabbit Polyclonal Antibody
TA316586

USD 515.00

2 Weeks

CALCRL / CRLR Rabbit Polyclonal (Cytoplasmic Domain) Antibody

Applications IHC
Reactivities Bovine, Dog, Xenopus, Gorilla, Goat, Human, Monkey, Pig, Rabbit, Rat, Gibbon, Hamster, Horse, Orang-Utan (Predicted: Mouse, Bat, Zebrafish, Guinea Pig)
Conjugation Unconjugated
Immunogen CALCRL / CGRP Receptor antibody was raised against synthetic 16 amino acid peptide from 3rd cytoplasmic domain of human CALCRL. Percent identity with other species by BLAST analysis: Human, Gorilla, Orangutan, Gibbon, Monkey, Marmoset, Rat, Goat, Hamster, Panda, Dog, Bovine, Horse, Rabbit, Pig, Opossum, Xenopus (100%); Mouse, Elephant, Bat, Guinea pig, Stickleback, Pufferfish, Zebrafish (94%); Turkey, Chicken (81%).
RHOC Rabbit Polyclonal Antibody
TA333447

USD 539.00

5 Days

Rabbit Polyclonal Anti-RHOC Antibody

Applications IHC, WB
Reactivities Human, Cow, Dog, Goat, Guinea Pig, Horse, Mouse, Rabbit, Rat, Sheep, Yeast, Zebrafish, Brugia malayi
Conjugation Unconjugated
Immunogen The immunogen for Anti-RHOC Antibody: synthetic peptide directed towards the N terminal of human RHOC. Synthetic peptide located within the following region: VPTVFENYIADIEVDGKQVELALWDTAGQEDYDRLRPLSYPDTDVILMCF
Thrombospondin 1 (THBS1) (19-32) Goat Polyclonal Antibody
AP23121PU-N

USD 500.00

2 Weeks

Thrombospondin 1 (THBS1) (19-32) goat polyclonal antibody, Aff - Purified

Applications IHC
Reactivities Canine, Equine, Goat, Human, Monkey, Mouse, Porcine, Rabbit, Rat, Bovine
Conjugation Unconjugated
Immunogen Synthetic peptide from N-Terminus of human THBS1 (NP_003237.2)
TNFRSF1A (195-211) Rabbit Polyclonal Antibody
AP23346PU-N

USD 560.00

2 Weeks

TNFRSF1A (195-211) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Goat, Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide corresponding to a sequencein the middle region of Human TNFR1 (aa 195-211).
PAK6 Rabbit Polyclonal Antibody
TA340992

USD 515.00

5 Days

Rabbit Polyclonal Anti-PAK6 Antibody (Linker Domain)

Applications IHC
Reactivities Human (Predicted: Goat, Rabbit)
Conjugation Unconjugated
Immunogen PAK6 antibody was raised against synthetic 18 amino acid peptide from Linker domain of human PAK6. Percent identity with other species by BLAST analysis: Human, Gorilla, Orangutan, Gibbon, Monkey, Marmoset, Dog, Horse (100%); Goat, Elephant, Panda, Rabbit (94%); Hamster, Bovine (89%); Mouse, Bat (83%).
Luteinizing Hormone beta (LHB) Rabbit Polyclonal Antibody
AP02115SU-N

USD 525.00

2 Weeks

Luteinizing Hormone beta (LHB) rabbit polyclonal antibody, Serum

Applications ELISA, IHC, R, WB
Reactivities Bovine, Deer, Goat, Human, Sheep
Conjugation Unconjugated
Immunogen Bovine Luteinizing Hormone
IGFBP5 Rabbit Polyclonal Antibody
TA316916

USD 535.00

2 Weeks

Anti-IGFBP-5 Rabbit Polyclonal Antibody

Applications IHC
Reactivities Bat, Bovine, Dog, Gorilla, Goat, Human, Monkey, Pig, Rabbit, Gibbon, Hamster, Horse (Predicted: Mouse, Rat, Chicken)
Conjugation Unconjugated
Immunogen IGFBP5 antibody was raised against human IGFBP5 amino acids 192-206 (CRRHMEASLQELKAS). Percent identity by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Dog, Bat, Bovine, Goat, Hamster, Elephant, Panda, Horse, Rabbit, Pig (100%); Mouse, Rat, Opossum, Chicken (93%); Marmoset (87%).