Rabbit Polyclonal Anti-CBS Antibody
| Applications | IHC, WB |
| Reactivities | Human, Rat, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CBS antibody: synthetic peptide directed towards the N terminal of human CBS. Synthetic peptide located within the following region: RCIIVMPEKMSSEKVDVLRALGAEIVRTPTNARFDSPESHVGVAWRLKNE |
Rabbit Polyclonal Antibody against MAT2 alpha
| Applications | ICC/IF, IHC, IP, Simple Western, WB |
| Reactivities | Human, Rat, Bovine, Zebrafish, Monkey, Orang-Utan (Does not react with: Mouse) |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide made to an N terminal portion of the human protein (within residues 1-100). [Swiss-Prot# P31153] |
Rabbit Polyclonal antibody to CBS (cystathionine-beta-synthase)
| Applications | IF, IHC, IP, WB |
| Reactivities | Human (Predicted: Mouse, Rabbit, Rat, Bovine, X. tropicalis) |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 39 and 251 of CBS (Uniprot ID#P35520) |
Rabbit Polyclonal Anti-GGT1 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human GGT1 |
Rabbit polyclonal antibody to Selenophosphate synthetase 1 (selenophosphate synthetase 1)
| Applications | IF, IHC, WB |
| Reactivities | Human (Predicted: Rat, Chicken, Chimpanzee, Bovine, Rhesus Monkey) |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 1 and 204 of Selenophosphate synthetase 1 (Uniprot ID#P49903) |
Rabbit Polyclonal antibody to AHCYL2 (adenosylhomocysteinase-like 2)
| Applications | IF, IHC, WB |
| Reactivities | Human (Predicted: Mouse, Rat, Bovine, X. tropicalis) |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 298 and 578 of AHCYL2 (Uniprot ID#Q96HN2) |
GGT1 Rabbit Polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human GGT1 |
Germany
Japan
United Kingdom
China
