Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Goat Polyclonal Antibody against DKK1
| Applications | FC, IF, IHC, PEP-ELISA, WB |
| Reactivities | Human (Expected from sequence similarity: Rat, Dog, Pig, Cow) |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence CDHHQASNSSRLHT, from the C Terminus of the protein sequence according to NP_036374. |
Rabbit polyclonal EGFR (Ab-1172) antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human EGFR around the phosphorylation site of tyrosine 1172 (P-D-YP-Q-Q). |
Rabbit Polyclonal Antibody against NANOG (N-term)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human (Predicted: Monkey) |
| Conjugation | Unconjugated |
| Immunogen | This NANOG antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 15-49 amino acids from the N-terminal region of human NANOG. |
Rabbit Polyclonal Anti-WNT5A Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-WNT5A antibody: synthetic peptide directed towards the middle region of human WNT5A. Synthetic peptide located within the following region: GGCGDNIDYGYRFAKEFVDARERERIHAKGSYESARILMNLHNNEAGRRT |
DLL4 rabbit polyclonal antibody, Purified
| Applications | ELISA, IHC, WB |
| Reactivities | Human, Monkey, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to the internal region of human DLL4. |
Active filters
Applications
- IHC
Clonalities
- Polyclonal
Families
- Cancer stem cells
Citations
- Yes
Filter by
Category
Antibody Hosts
Conjugates
Assay Types
Pathways
- Hedgehog signaling pathway (3)
- Pathways in cancer (3)
- Wnt signaling pathway (3)
- Basal cell carcinoma (2)
- Melanogenesis (2)
- Adherens junction (1)
- Bladder cancer (1)
- Calcium signaling pathway (1)
- Colorectal cancer (1)
- Cytokine-cytokine receptor interaction (1)
- Dorso-ventral axis formation (1)
- Endocytosis (1)
- Endometrial cancer (1)
- Epithelial cell signaling in Helicobacter pylori infection (1)
- ErbB signaling pathway (1)
- Focal adhesion (1)
- Gap junction (1)
- Glioma (1)
- GnRH signaling pathway (1)
- MAPK signaling pathway (1)
- Melanoma (1)
- Non-small cell lung cancer (1)
- Notch signaling pathway (1)
- Pancreatic cancer (1)
- Prostate cancer (1)
- Regulation of actin cytoskeleton (1)
- TGF-beta signaling pathway (1)