Histidine decarboxylase (HDC) rabbit polyclonal antibody, Serum
Applications | IF, IHC, WB |
Reactivities | Canine, Guinea Pig, Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant Histidine Decarboxylase produced in E.coli. |
Histidine decarboxylase (HDC) rabbit polyclonal antibody, Serum
Applications | IF, IHC, WB |
Reactivities | Canine, Guinea Pig, Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant Histidine Decarboxylase produced in E.coli. |
Calca goat polyclonal antibody, Purified
Applications | ELISA, IF, IHC |
Reactivities | Mouse, Reptiles, Rat, Guinea Pig |
Conjugation | Unconjugated |
Immunogen | Synthetic Rat Tyr-CGRP (23-37) conjugated to gamma Globulin |
Rabbit Polyclonal HIF-1 alpha Antibody
Applications | ChIP, ELISA, ICC/IF, IHC, Immunoblotting, IP, Simple Western, WB |
Reactivities | Human, Mouse, Rat, Canine, Guinea Pig, Primate, Xenopus |
Conjugation | Unconjugated |
Immunogen | Fusion protein made to an internal sequence of human HIF-1 alpha (containing amino acids 432-528) [UniProt Q16665] |
Rabbit Polyclonal MUC-1 Antibody
Applications | FC, ICC/IF, IHC, WB |
Reactivities | Human, Mouse, Rat, Bovine, Equine, Guinea Pig, Porcine |
Conjugation | Unconjugated |
Immunogen | Synthetic peptides corresponding to MUC1(mucin 1, cell surface associated) The peptide sequence was selected from the C terminal region between aa 1200-1250 of human MUC1 (NP_001037855). Peptide sequence GQLDIFPARDTYHPMSEYPTYHTHGRYVPPSSTDRSPYEKVSAGNGGSSL. |
Rabbit Polyclonal antibody to alpha 1a Adrenergic Receptor (adrenergic, alpha-1A-, receptor)
Applications | IF, IHC, WB |
Reactivities | Human (Predicted: Bovine, Dog, Pig, Rabbit, Guinea Pig, Rhesus Monkey) |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide contain a sequence corresponding to a region within amino acids 206 and 260 of alpha 1a Adrenergic Receptor (Uniprot ID#P35348) |
Annexin A1 (ANXA1) (324-337) goat polyclonal antibody, Aff - Purified
Applications | ELISA, IHC, WB |
Reactivities | Bovine, Canine, Human, Mouse, Porcine, Rat, Bat, Equine, Guinea Pig, Hamster, Monkey, Rabbit |
Conjugation | Unconjugated |
Immunogen | Peptide from the C Terminus of the protein sequence according to NP_000691.1 |
TLR3 (514-657) rabbit polyclonal antibody, Aff - Purified
Applications | IF, IHC, WB |
Reactivities | Bovine, Feline, Guinea Pig, Human, Monkey, Mouse, Porcine, Rabbit, Rat |
Conjugation | Unconjugated |
Immunogen | TLR3 antibody was raised against recombinant protein fragment containing a sequence corresponding to a region within amino acids 514 and 657 of TLR3. |
Rabbit polyclonal antibody to NQO1 (NAD(P)H dehydrogenase, quinone 1)
Applications | IF, IHC, WB |
Reactivities | Human (Predicted: Pig, Bovine, Guinea Pig, Rhesus Monkey) |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region within amino acids 213 and 274 of NQO1 (Uniprot ID#P15559) |
USD 515.00
In Stock
CHRM3 / M3 Rabbit Polyclonal (C-Terminus) Antibody
Applications | IHC |
Reactivities | Gorilla, Human, Monkey, Gibbon, Orang-Utan (Predicted: Mouse, Rat, Bovine, Dog, Hamster, Horse, Pig, Rabbit, Sheep, Guinea Pig) |
Conjugation | Unconjugated |
Immunogen | CHRM3 / M3 antibody was raised against synthetic 19 amino acid peptide from C-terminus of human CHRM3 / M3. Percent identity with other species by BLAST analysis: Human, Gorilla, Orangutan, Gibbon, Monkey (100%); Chimpanzee, Mouse, Rat, Sheep, Hamster, Elephant, Dog, Bovine, Horse, Rabbit, Pig, Guinea pig (95%); Opossum, Turkey, Chicken, Lizard (89%). |
Rabbit Polyclonal Neurokinin 1 Receptor Antibody
Applications | FC, ICC/IF, IHC, WB |
Reactivities | Guinea Pig, Human, Rat |
Conjugation | Unconjugated |
Immunogen | A peptide derived from the N-terminus of human NK-1 sequence conjugated to KLH. |
Rabbit Polyclonal antibody to beta Actin (actin, beta)
Applications | IF, IHC, WB |
Reactivities | Human (Predicted: Rat, Dog, Rabbit, Chicken, Sheep, Chimpanzee, Bovine, Guinea Pig, Rhesus Monkey, Mouse) |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide contain a sequence corresponding to a region within amino acids 309 and 358 of beta Actin |
Mu Opioid Receptor (OPRM1) (384-398) rabbit polyclonal antibody
Applications | IF, IHC, WB |
Reactivities | Guinea Pig, Human, Mouse, Rat |
Conjugation | Unconjugated |
Hsp40 (DNAJB1) rabbit polyclonal antibody, Purified
Applications | IHC, IP, WB |
Reactivities | Bovine, Canine, Chicken, Fish, Guinea Pig, Hamster, Human, Monkey, Mouse, Porcine, Rabbit, Rat, Sheep, Xenopus |
Conjugation | Unconjugated |
Immunogen | Recombinant human Hsp40 protein |
CALCRL / CRLR Rabbit Polyclonal (Cytoplasmic Domain) Antibody
Applications | IHC |
Reactivities | Bovine, Dog, Xenopus, Gorilla, Goat, Human, Monkey, Pig, Rabbit, Rat, Gibbon, Hamster, Horse, Orang-Utan (Predicted: Mouse, Bat, Zebrafish, Guinea Pig) |
Conjugation | Unconjugated |
Immunogen | CALCRL / CGRP Receptor antibody was raised against synthetic 16 amino acid peptide from 3rd cytoplasmic domain of human CALCRL. Percent identity with other species by BLAST analysis: Human, Gorilla, Orangutan, Gibbon, Monkey, Marmoset, Rat, Goat, Hamster, Panda, Dog, Bovine, Horse, Rabbit, Pig, Opossum, Xenopus (100%); Mouse, Elephant, Bat, Guinea pig, Stickleback, Pufferfish, Zebrafish (94%); Turkey, Chicken (81%). |
5HT7 Receptor (HTR7) (C-term) rabbit polyclonal antibody, Aff - Purified
Applications | ELISA, IHC |
Reactivities | Human, Mouse, Bovine, Bat, Canine, Equine, Guinea Pig, Hamster, Monkey, Porcine, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic 20 amino acid peptide from C-terminal region of Human HTR7 / 5-HT7 |