Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit polyclonal RELA Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide conjugated to KLH derived from within residues 100 - 170 of Human RELA. |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
Rabbit anti-NF-kB p105/p50 (Phospho-Ser337) polyclonal antibody (Phospho-specific)
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from humanNF-κB p105/p50 around the phosphorylation site of serine 337 (R-K-SP-D-L). |
| Modifications | Phospho-specific |
Rabbit Polyclonal NFkB1/NFkB p105 Antibody
| Applications | ICC/IF, IHC, Simple Western, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | A genomic peptide made to an N-terminal region of the human NFkB p105/p50 protein (within residues 400-590). [Swiss-Prot P19838] |
Rabbit Polyclonal antibody to PPP3CB (protein phosphatase 3, catalytic subunit, beta isozyme)
| Applications | IHC, WB |
| Reactivities | Human, Mouse (Predicted: Chicken, Rabbit, Rat, Xenopus, Bovine, X. tropicalis) |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 1 and 228 of PPP3CB (Uniprot ID#P16298) |
Anti-NFKBIE Rabbit Polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to a region derived from 63-423 amino acids of human nuclear factor of kappa light polypeptide gene enhancer in B-cells inhibitor, epsilon |
Anti-NFKBIE Rabbit Polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to a region derived from 63-423 amino acids of human nuclear factor of kappa light polypeptide gene enhancer in B-cells inhibitor, epsilon |
Rabbit Polyclonal NFkB p65 NLS Antibody
| Applications | ICC/IF, IHC, WB |
| Reactivities | Human, Mouse, Bovine, Equine, Primate |
| Conjugation | Unconjugated |
| Immunogen | A portion of the NFkB p65 NLS nuclear localization signal (NLS) (amino acids DTDDRHRIEEKRKRKT) was used as the immunogen for this antibody. |
Anti-NFATC2 Rabbit Polyclonal Antibody
| Applications | IHC |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 2-15 amino acids of human nuclear factor of activated T-cells, cytoplasmic, calcineurin-dependent 2 |
Rabbit Polyclonal Anti-NFATC3 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-NFATC3 antibody: synthetic peptide directed towards the N terminal of human NFATC3. Synthetic peptide located within the following region: AVFPFQYCVETDIPLKTRKTSEDQAAILPGKLELCSDDQGSLSPARETSI |
Active filters
Category
- Antibodies
Reactivities
- Mouse
Applications
- IHC
Clonalities
- Polyclonal
Families
- Transcription Factors
Pathways
- B cell receptor signaling pathway