Antibodies

Jump to Filters
View as table Download
Perilipin-1 (PLIN1) Guinea Pig Polyclonal Antibody
BP5015

USD 540.00

2 Weeks

Perilipin-1 (PLIN1) guinea pig polyclonal antibody, Serum

Applications IHC, WB
Reactivities Bovine, Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Duplicated N-terminus of Perilipin, aa 1-20 (cf. Greenberg et al. 1992, JBC 266, 11341-11346)
CYP8B1 Rabbit Polyclonal Antibody
TA313734

USD 380.00

2 Weeks

Rabbit polyclonal Cytochrome P450 8B1 antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human Cytochrome P450 8B1.
CYP27A1 Rabbit Polyclonal Antibody
AP06773PU-N

USD 465.00

3 Weeks

CYP27A1 rabbit polyclonal antibody, Aff - Purified

Applications ELISA, IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to amino acids 100-150 of Human CYP27A1.
ACSL3 Rabbit Polyclonal Antibody
TA339415

USD 539.00

2 Weeks

Rabbit Polyclonal Anti-ACSL3 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ACSL3 antibody: synthetic peptide directed towards the N terminal of human ACSL3. Synthetic peptide located within the following region: LDGLASVLYPGCDTLDKVFTYAKNKFKNKRLLGTREVLNEEDEVQPNGKI
FACL4 (ACSL4) Rabbit Polyclonal Antibody
TA324720

USD 580.00

2 Weeks

Rabbit polyclonal ACSL4 (FACL4) Antibody (Center)

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This ACSL4 (FACL4) antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 236-267 amino acids from the Central region of human ACSL4 (FACL4).
PPAR delta (PPARD) (430-441) Goat Polyclonal Antibody
AP23032PU-N

USD 500.00

2 Weeks

PPAR delta (PPARD) (430-441) goat polyclonal antibody, Aff - Purified

Applications ELISA, IHC, WB
Reactivities Human, Bovine, Bat, Canine, Chicken, Equine, Hamster, Monkey, Mouse, Porcine, Rabbit, Rat, Zebrafish
Conjugation Unconjugated
Immunogen Synthetic peptide from the C-terminus of human PPARD
UCP1 Rabbit Polyclonal Antibody
TA326708

USD 570.00

2 Weeks

Rabbit Polyclonal UCP1 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen UCP1 antibody was raised against a 17 amino acid peptide near the carboxy terminus of human UCP1 (GenBank accession.
UCP1 Rabbit Polyclonal Antibody
TA351889

USD 380.00

4 Weeks

Rabbit Polyclonal Anti-UCP1 Antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide of human UCP1
SORBS1 Goat Polyclonal Antibody
TA302800

USD 520.00

5 Days

Goat Polyclonal Antibody against SORBS1

Applications IHC
Reactivities Human (Expected from sequence similarity: Mouse, Rat, Pig)
Conjugation Unconjugated
Immunogen Peptide with sequence C-GTFPGNYVKPLYL, from the C Terminus of the protein sequence according to NP_006425.2; NP_056200.1; NP_001030126.1; NP_001030127.1; NP_001030128.1; NP_079267.1; NP_001030129.1.
Perilipin-1 (PLIN1) (C-term) Guinea Pig Polyclonal Antibody
BP5033

USD 525.00

2 Weeks

Perilipin-1 (PLIN1) (C-term) guinea pig polyclonal antibody, Serum

Applications IHC, WB
Reactivities Bovine, Human
Conjugation Unconjugated
Immunogen C-terminus of Perilipin-1 (hCTA/B; aa 507-519; cf. Greenberg et al. 1992, JBC 266, 11341-11346)