Antibodies

Jump to Filters
View as table Download
HLX1 (HLX) Rabbit Polyclonal Antibody
TA314009

USD 380.00

In Stock

Rabbit polyclonal anti-HLX1 antibody

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human HLX1.
HLX1 (HLX) Rabbit Polyclonal Antibody
TA330095

USD 485.00

5 Days

Rabbit Polyclonal Anti-HLX Antibody

Applications IF, WB
Reactivities Human, Xenopus
Conjugation Unconjugated
Immunogen The immunogen for anti-HLX1 antibody: synthetic peptide directed towards the middle region of human HLX1 (Cat# AAP31195). Synthetic peptide located within the following region: PGPYAVLTKDTMPQTYKRKRSWSRAVFSNLQRKGLEKRFEIQKYVTKPDR