Antibodies

View as table Download

Rabbit Polyclonal Anti-Angiotensin II Receptor Type-1 (extracellular)

Applications FC, IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Peptide NSSTEDGIKRIQDDC, corresponding to amino acid residues 4-18 of human AT1 receptor. Extracellular, N-terminus.

Rabbit Polyclonal S1P1 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen S1P1 antibody was raised against a 14 amino acid synthetic peptide near the carboxy terminus of the human S1P1. The immunogen is located within the last 50 amino acids of S1P1.

Goat Polyclonal Antibody against HCRTR1

Applications IF, WB
Reactivities Human, Mouse, Rat (Expected from sequence similarity: Dog, Pig, Cow)
Conjugation Unconjugated
Immunogen Peptide with sequence C-YNFLSGKFREQFK, from the internal region of the protein sequence according to NP_001516.1; NP_001517.1.

Rabbit polyclonal Anti-P2X1 Receptor (extracellular)

Applications FC, IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Peptide CRPIYEFHGLYEEK, corresponding to amino acid residues 270-283 of human P2X1 receptor . Extracellular loop.

Rabbit Polyclonal Anti-Protease-activated Receptor-4 (extracellular)

Applications FC, IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Peptide (C)HLRGQRWPFGEAA(S)R, corresponding to amino acid residues 136-150 of human PAR-4. Cys 149 was replaced with Ser. 1st extracellular loop.

5HT7 Receptor (HTR7) (8-23) rabbit polyclonal antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Rabbit polyclonal GR (Ab-211) antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized non-phosphopeptide derived from human GR around the phosphorylation site of serine 211 (N-E-S-P-W).

Rabbit polyclonal Anti-VPAC1 (extracellular)

Applications FC, IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Peptide (C)EEAQLENETIG(S)SK, corresponding to amino acid residues 52-65 of human VPAC1 (Accession P32241). Extracellular, N-terminus.

Rabbit Polyclonal AGTR1 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen AGTR1 antibody was raised against a 16 amino acid peptide from near the center of human AGTR1.

Rabbit Polyclonal Anti-Melanocortin Receptor 4 (extracellular)

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Peptide (C)HRGMHTSLHLWNRSS, corresponding to amino acid residues 6-20 of human MC4R. Extracellular, N terminal.

Rabbit Polyclonal MC4R Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen MC4R antibody was raised against a 19 amino acid peptide near the amino terminus of human MC4R.

Rabbit Polyclonal Anti-A1 Adenosine Receptor

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Peptide (C)KKVSASSGDPQKYYGKE, corresponding to amino acid residues 213-229 of human A1AR. 3rd intracellular loop.

Rabbit Polyclonal anti-HTR2B antibody

Applications IF, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-HTR2B antibody: synthetic peptide directed towards the N terminal of human HTR2B. Synthetic peptide located within the following region: QTESIPEEMKQIVEEQGNKLHWAALLILMVIIPTIGGNTLVILAVSLEKK

Glucagon Receptor (GCGR) rabbit polyclonal antibody, Aff - Purified

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to amino acids 100-150 of Human Glucagon Receptor.

Rabbit polyclonal anti-VIPR2 antibody

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human VIPR2.