Rabbit Polyclonal Aggrecan Neoepitope Antibody
| Applications | FC, ICC/IF, IHC, WB |
| Reactivities | Human, Mouse, Rat, Bovine, Canine, Porcine |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide corresponding to a region of human Aggrecan (within residues 350-400). [UniProt# P16112] |
Rabbit Polyclonal Antibody against HMGB1 - Oligodendrocyte Marker
| Applications | ELISA, FC, ICC/IF, IHC, Simple Western, WB |
| Reactivities | Human, Mouse, Dog, Bovine, Hamster, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide made to an internal portion of the human HMGB1 protein sequence (between residues 100-200). [UniProt #P09429] |
Rabbit Polyclonal Calnexin Antibody
| Applications | FC, ICC/IF, IHC, IP, Simple Western, WB |
| Reactivities | Human, Mouse, Rat, Bovine, Chicken, Avian, Drosophila |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide made to an internal region of the canine Calnexin protein (within residues 25-100). [Swiss-Prot P24643] |
Rabbit Polyclonal LRRK2 Antibody
| Applications | FC, ICC/IF, IHC, IP, WB |
| Reactivities | Bovine, Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | A C-terminal synthetic peptide made to the human LRRK2 protein sequence (between residues 2500-2527). |
Rabbit polyclonal anti-COX IV antibody, Loading control
| Applications | ChIP, ICC, ICC/IF, IHC, Simple Western, WB |
| Reactivities | Human, Mouse, Bovine, Primate, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide made to an internal region of the human COX4-1 protein (within residues 1-100). [Swiss-Prot# P13073] |
Rabbit Polyclonal Antibody against Eg5
| Applications | ICC/IF, Immunoblotting, IP, WB |
| Reactivities | Human, Mouse, Bovine, Goat, Hamster, Sheep |
| Conjugation | Unconjugated |
| Immunogen | Produced by immunization of rabbits with a recombinant segment of the coiled-coil domain of the human protein. |
Rabbit Polyclonal Calreticulin Antibody
| Applications | Block/Neutralize, Dot, Electron Microscopy, FC, ICC/IF, IHC, IP, Protein Array, Simple Western, WB |
| Reactivities | Human, Mouse, Rat, Bovine, Hamster, Primate |
| Conjugation | Unconjugated |
| Immunogen | A fusion protein to mouse Calreticulin [UniProt# P14211] |
Rabbit Polyclonal PKM2 Antibody
| Applications | FC, ICC/IF, IHC, Immunoblotting, IP, Simple Western, WB |
| Reactivities | Bovine, Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide made to the internal region of human PKM2 protein (within residues 350-450). [Swiss-Prot# P14618] |
Rabbit Polyclonal Antibody against MAT2 alpha
| Applications | ICC/IF, IHC, IP, Simple Western, WB |
| Reactivities | Human, Rat, Bovine, Zebrafish, Monkey, Orang-Utan (Does not react with: Mouse) |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide made to an N terminal portion of the human protein (within residues 1-100). [Swiss-Prot# P31153] |
Rabbit Polyclonal Perilipin Antibody
| Applications | FC, ICC/IF, IHC, WB |
| Reactivities | Bovine, Human, Mouse, Porcine, Rat, Sheep |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide made to a region between residues 450-522 (C-terminus) of the human perilipin protein. [Swiss-Prot# O60240] |
Rabbit Polyclonal LC3/MAP1LC3A Antibody
| Applications | FC, ICC/IF, IHC, Simple Western, WB |
| Reactivities | Human, Mouse, Rat, Bovine, Zebrafish |
| Conjugation | Unconjugated |
| Immunogen | Genomic sequence made to an N-terminal portion of the human LC3A protein [Swiss-Prot# Q9H492]. |
Rabbit Polyclonal MUC-1 Antibody
| Applications | FC, ICC/IF, IHC, WB |
| Reactivities | Human, Mouse, Rat, Bovine, Equine, Guinea Pig, Porcine |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptides corresponding to MUC1(mucin 1, cell surface associated) The peptide sequence was selected from the C terminal region between aa 1200-1250 of human MUC1 (NP_001037855). Peptide sequence GQLDIFPARDTYHPMSEYPTYHTHGRYVPPSSTDRSPYEKVSAGNGGSSL. |
Germany
Japan
United Kingdom
China
