Antibodies

Jump to Filters
View as table Download
IL22 Rabbit Polyclonal Antibody
TA326688

USD 570.00

2 Weeks

Rabbit Polyclonal IL-22 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen IL-22 antibody was raised against a 17 amino acid peptide near the center of human IL-22
IL22 Rabbit Polyclonal Antibody
TA338422

USD 539.00

2 Weeks

Rabbit Polyclonal Anti-IL22 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-IL22 antibody: synthetic peptide directed towards the C terminal of human IL22. Synthetic peptide located within the following region: CHIEGDDLHIQRNVQKLKDTVKKLGESGEIKAIGELDLLFMSLRNACI
IL22 Rabbit Polyclonal Antibody
PP1224P2

USD 465.00

2 Weeks

IL22 rabbit polyclonal antibody, Aff - Purified

Applications ELISA, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Highly pure (>98%) E.coli derived recombinant Human Interleukin-22 (hIL-22).
IL22 Rabbit Polyclonal Antibody
PP1224B1

USD 345.00

2 Weeks

IL22 rabbit polyclonal antibody, Biotin

Applications ELISA, WB
Reactivities Human
Conjugation Biotin
Immunogen Highly pure (>98%) E.coli derived recombinant Human IL-22 (hIL-22).
IL22 Rabbit Polyclonal Antibody
PP1224B2

USD 465.00

2 Weeks

IL22 rabbit polyclonal antibody, Biotin

Applications ELISA, WB
Reactivities Human
Conjugation Biotin
Immunogen Highly pure (>98%) E.coli derived recombinant Human IL-22 (hIL-22).
IL22 Rabbit Polyclonal Antibody
PP1224P1

USD 345.00

2 Weeks

IL22 rabbit polyclonal antibody, Aff - Purified

Applications ELISA, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Highly pure (>98%) E.coli derived recombinant Human Interleukin-22 (hIL-22).