Germany
Japan
United Kingdom
China
Rabbit Polyclonal PCNA Antibody
| Applications | ELISA, IHC, WB |
| Reactivities | Human, Dog, Rat, Monkey, Mouse |
| Conjugation | Unconjugated |
| Immunogen | DNA immunization. This antibody is specific for the Middle Region of the target protein. |
Antibodies
View as table Download
Rabbit Polyclonal HDAC2 Antibody
| Applications | ELISA, IHC, WB |
| Reactivities | Human, Dog, Rat, Monkey, Mouse |
| Conjugation | Unconjugated |
| Immunogen | DNA immunization. This antibody is specific for the C Terminus Region of the target protein. |
Rabbit Polyclonal c-Myc Antibody
| Applications | ChIP, ELISA, ICC/IF, IHC, IP, Simple Western, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide made to the human c-Myc protein (between residues 400-450) [UniProt P01106] |
Rabbit Polyclonal anti-TP53 antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TP53 antibody: synthetic peptide directed towards the N terminal of human TP53. Synthetic peptide located within the following region: EEPQSDPSVEPPLSQETFSDLWKLLPENNVLSPLPSQAMDDLMLSPDDIE |
Rabbit monoclonal anti-CHK1 antibody for SISCAPA, clone OTIR3G7
| Applications | SISCAPA |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Rabbit polyclonal anti-HDAC-1 antibody
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Anti-HDAC-1 antibody was prepared from whole rabbit serum produced by repeated immunizations with a synthetic peptide corresponding to amino acids 466-482 of Human HDAC-1. |
Rabbit Polyclonal antibody to c-Myc (v-myc myelocytomatosis viral oncogene homolog (avian))
| Applications | FC, IF, WB |
| Reactivities | Human, Mouse (Predicted: Rat, Dog, Feline, Pig, Sheep, Chimpanzee, Bovine, Rhesus Monkey) |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region within amino acids 1 and 52 of c-Myc (Uniprot ID#P01106) |
Active filters
Reactivities
- Human
Antibody Hosts
- Rabbit
Families
- Stem cell - Pluripotency
Pathways
- Cell cycle
Filter by
Category
Target Symbol
- P53 (49)
- CHK1 (24)
- CHK2 (20)
- CYCLIN B1 (19)
- C-MYC (18)
- CDK1 (18)
- HDAC2 (16)
- HDAC1 (15)
- CYCLIN D1 (11)
- CYCLIN E1 (9)
- MCM3 (9)
- MCM5 (9)
- APC1 (8)
- MCM6 (8)
- PCNA (8)
- CDK7 (7)
- CYCLIN A2 (7)
- CDC25C (6)
- CDC7 (5)
- CYCLIN B2 (5)
- MCM2 (5)
- BUBR1 (4)
- CDC2 (4)
- GADD45A (4)
- MCM4 (4)
- CDC45L (2)
- ORC2 (2)
- ORC6L (2)
- WEE1 (2)
- ORC1 (1)