Germany
Japan
United Kingdom
China
Rabbit Polyclonal Antibody against Survivin - Astrocyte Marker
| Applications | ChIP, ELISA, FC, ICC/IF, IHC, IP, Simple Western, WB |
| Reactivities | Human, Mouse, Rat, Feline, Dog |
| Conjugation | Unconjugated |
| Immunogen | Full-length recombinant human survivin. |
Antibodies
View as table Download
Rabbit Polyclonal Antibody against HMGB1 - Oligodendrocyte Marker
| Applications | ELISA, FC, ICC/IF, IHC, Simple Western, WB |
| Reactivities | Human, Mouse, Dog, Bovine, Hamster, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide made to an internal portion of the human HMGB1 protein sequence (between residues 100-200). [UniProt #P09429] |
Rabbit Polyclonal PCNA Antibody
| Applications | ELISA, IHC, WB |
| Reactivities | Human, Dog, Rat, Monkey, Mouse |
| Conjugation | Unconjugated |
| Immunogen | DNA immunization. This antibody is specific for the Middle Region of the target protein. |
Rabbit Polyclonal Ku80 Antibody
| Applications | ELISA, IHC, WB |
| Reactivities | Human, Dog, Monkey, Mouse |
| Conjugation | Unconjugated |
| Immunogen | DNA immunization. This antibody is specific for the C Terminus Region of the target protein. |
Rabbit polyclonal TK (Ab-13) antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human TK around the phosphorylation site of serine 13 (P-G-SP-P-S). |
Rabbit Polyclonal HDAC2 Antibody
| Applications | ELISA, IHC, WB |
| Reactivities | Human, Dog, Rat, Monkey, Mouse |
| Conjugation | Unconjugated |
| Immunogen | DNA immunization. This antibody is specific for the C Terminus Region of the target protein. |
Rabbit Polyclonal Antibody against APE1
| Applications | Block/Neutralize, ChIP, FC, ICC/IF, IHC, IP, Simple Western, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Affinity purified human Apurinic/Apyrimidinic Endonuclease (APE/ref-1) fusion protein. |
Rabbit Polyclonal antibody to Proteasome 20S alpha 6 (proteasome (prosome, macropain) subunit, alpha type, 6)
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse (Predicted: Chimpanzee, Bovine, Rhesus Monkey) |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment contain a sequence corresponding to a region within amino acids 57 and 246 of Proteasome 20S alpha 6 |
Rabbit Polyclonal Anti-HSPA8 Antibody
| Applications | IHC, WB |
| Reactivities | Rat, Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-HSPA8 antibody: synthetic peptide directed towards the N terminal of human HSPA8. Synthetic peptide located within the following region: MSKGPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERL |
Rabbit Polyclonal anti-HSPA9 antibody
| Applications | IHC, IP, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-HSPA9 antibody: synthetic peptide directed towards the C terminal of human HSPA9. Synthetic peptide located within the following region: GENIRQAASSLQQASLKLFEMAYKKMASEREGSGSSGTGEQKEDQKEEKQ |
Rabbit monoclonal anti-RFA2 antibody for SISCAPA, clone OTIR2G2
| Applications | SISCAPA |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Rabbit monoclonal anti-CHK1 antibody for SISCAPA, clone OTIR3G7
| Applications | SISCAPA |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Active filters
Category
-
Antibodies
- Primary Antibodies
Reactivities
- Mouse
Antibody Hosts
- Rabbit
Isotypes
- IgG
Families
- Stem cell - Pluripotency
Filter by
Target Symbol
- HDAC2 (14)
- P53 (13)
- CYCLIN B1 (12)
- HDAC1 (11)
- LCK (11)
- PAK1 (11)
- C-MYC (10)
- CHK2 (10)
- HSP60 (10)
- HSP90AB1 (10)
- BCL2 (9)
- CASPASE 9 (9)
- PAXILLIN (9)
- CHK1 (8)
- IKB BETA (8)
- RAD51 (8)
- SOCS1 (8)
- VASP (8)
- CASPASE-6 (7)
- CTBP2 (7)
- CYCLIN D1 (7)
- PCNA (7)
- RPA34 (7)
- APC1 (6)
- C-MYB (6)
- CARDIAC TROPONIN I (6)
- CD117 (6)
- CDK1 (6)
- HMG1 (6)
- MRE11 (6)
- PARP1 (6)
- PHAP1 (6)
- PIAS2 (6)
- ACTIN (5)
- ANNEXIN A2 (5)
- BIRC5 (5)
- DNMT3B (5)
- GRP75 (5)
- MCM5 (5)
- OCT4 (5)
- SP1 (5)
- SUMO 1 (5)
- THYMIDINE KINASE 1 (5)
- UNG (5)
- APE1 (4)
- AURORA A (4)
- BAK (4)
- CYCLIN A2 (4)
- CYCLIN E1 (4)
- EWSR1 (4)
- GEMIN 2 (4)
- HSP105 (4)
- KPNA2 (4)
- MBD2 (4)
- MCM2 (4)
- MCM3 (4)
- NUCLEOPHOSMIN (4)
- PAK3 (4)
- PROFILIN 1 (4)
- SHP1 (4)
- SIRT1 (4)
- AATF (3)
- AIMP2 (3)
- CDK7 (3)
- CPN10 (3)
- GTF2H2 (3)
- HMGA1 (3)
- HSC70 (3)
- KU80 (3)
- MCM6 (3)
- MSH6 (3)
- PININ (3)
- PROTEASOME SUBUNIT ALPHA TYPE 6 (3)
- PROTHYMOSIN, ALPHA (3)
- PSMD11 (3)
- RFC2 (3)
- STIP1 (3)
- STXBP2 (3)
- TPX2 (3)
- APOLIPOPROTEIN E (2)
- ATIC (2)
- AURORA B (2)
- CKS2 (2)
- COPS3 (2)
- CXADR (2)
- EBP1 (2)
- ERBB 3 (2)
- FBP1 (2)
- FEN1 (2)
- FUBP1 (2)
- FUS (2)
- GOT2 (2)
- HNRNP Q (2)
- HPRT (2)
- MAP126 (2)
- MNAT1 (2)
- MYH (2)
- NANOG (2)
- NTH1 (2)
- ORC2 (2)
Applications
Clonalities
Conjugates
Modifications
Assay Types
Pathways
- Cell cycle (142)
- Pathways in cancer (125)
- p53 signaling pathway (72)
- Chronic myeloid leukemia (62)
- Small cell lung cancer (59)
- Colorectal cancer (58)
- Huntington's disease (52)
- Prostate cancer (52)
- Focal adhesion (48)
- DNA replication (43)
- Progesterone-mediated oocyte maturation (40)
- Endometrial cancer (39)
- MAPK signaling pathway (39)
- Apoptosis (38)
- T cell receptor signaling pathway (38)
- Wnt signaling pathway (38)
- Base excision repair (37)
- Pancreatic cancer (37)
- Jak-STAT signaling pathway (35)
- Oocyte meiosis (34)
- Amyotrophic lateral sclerosis (ALS) (32)
- Notch signaling pathway (32)
- Nucleotide excision repair (32)
- Bladder cancer (30)
- Neurotrophin signaling pathway (30)
- Thyroid cancer (30)
- Mismatch repair (29)
- Non-small cell lung cancer (29)
- Chemokine signaling pathway (28)
- Regulation of actin cytoskeleton (28)
- ErbB signaling pathway (27)
- Homologous recombination (26)
- Metabolic pathways (26)
- Natural killer cell mediated cytotoxicity (26)
- Acute myeloid leukemia (23)
- Ubiquitin mediated proteolysis (21)
- Glioma (20)
- Melanoma (20)
- Fc gamma R-mediated phagocytosis (19)
- NOD-like receptor signaling pathway (18)
- VEGF signaling pathway (18)
- Viral myocarditis (18)
- Leukocyte transendothelial migration (17)
- Primary immunodeficiency (16)
- RNA degradation (16)
- Axon guidance (15)
- Renal cell carcinoma (15)
- TGF-beta signaling pathway (15)
- Antigen processing and presentation (14)
- Basal cell carcinoma (13)
- B cell receptor signaling pathway (12)
- Alzheimer's disease (11)
- Endocytosis (11)
- Epithelial cell signaling in Helicobacter pylori infection (11)
- Non-homologous end-joining (11)
- Insulin signaling pathway (10)
- Type I diabetes mellitus (10)
- Parkinson's disease (9)
- Pyrimidine metabolism (9)
- Adipocytokine signaling pathway (8)
- Cytosolic DNA-sensing pathway (8)
- Drug metabolism - other enzymes (8)
- Gap junction (8)
- Proteasome (8)
- RIG-I-like receptor signaling pathway (8)
- Spliceosome (8)
- Type II diabetes mellitus (8)
- Cysteine and methionine metabolism (7)
- Purine metabolism (7)
- Cardiac muscle contraction (6)
- Cytokine-cytokine receptor interaction (6)
- Dilated cardiomyopathy (6)
- Hematopoietic cell lineage (6)
- Hypertrophic cardiomyopathy (HCM) (6)
- Melanogenesis (6)
- Adherens junction (4)
- Prion diseases (4)
- Basal transcription factors (3)
- One carbon pool by folate (3)
- Alanine (2)
- Arginine and proline metabolism (2)
- Calcium signaling pathway (2)
- Fructose and mannose metabolism (2)
- Glycolysis / Gluconeogenesis (2)
- Pentose phosphate pathway (2)
- Phenylalanine (2)
- Phenylalanine metabolism (2)
- Systemic lupus erythematosus (2)
- Tyrosine metabolism (2)
- aspartate and glutamate metabolism (2)
- tyrosine and tryptophan biosynthesis (2)
- ECM-receptor interaction (1)
- Folate biosynthesis (1)
- Glycine (1)
- Pathogenic Escherichia coli infection (1)
- SNARE interactions in vesicular transport (1)
- Steroid biosynthesis (1)
- serine and threonine metabolism (1)