Rabbit Polyclonal MUC-1 Antibody
| Applications | FC, ICC/IF, IHC, WB |
| Reactivities | Human, Mouse, Rat, Bovine, Equine, Guinea Pig, Porcine |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptides corresponding to MUC1(mucin 1, cell surface associated) The peptide sequence was selected from the C terminal region between aa 1200-1250 of human MUC1 (NP_001037855). Peptide sequence GQLDIFPARDTYHPMSEYPTYHTHGRYVPPSSTDRSPYEKVSAGNGGSSL. |
Rabbit Polyclonal Antibody against LOX
| Applications | ICC/IF, IHC, Simple Western, WB |
| Reactivities | Human, Mouse, Rat, Porcine, Cow |
| Conjugation | Unconjugated |
| Immunogen | A cocktail of two synthetic peptides; one made to a region of the human LOX protein within residues 300-400 and one within residues 200-300 |
Rabbit Polyclonal LOX propeptide Antibody
| Applications | ICC/IF, IHC, Immunoblotting, WB |
| Reactivities | Human, Mouse, Rat, Porcine, Primate |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide made to an internal region of mouse LOX propeptide (residues 78-115). [UniProt# P28301] |
Rabbit Polyclonal anti-CALR Antibody
| Applications | IF, WB |
| Reactivities | Human, Mouse, Rat, Bovine, Dog, Chicken, Drosophila, Fish, Monkey, Porcine, Rabbit, Sheep, Hamster, Guinea Pig |
| Conjugation | Unconjugated |
| Immunogen | Human calreticulin synthetic peptide with a cysteine residue added and the peptide conjugated to KLH |
Insulin (INS) rabbit polyclonal antibody
| Applications | IF, IHC |
| Reactivities | Bovine, Porcine, Rat |
| Conjugation | Unconjugated |
Chromogranin A (CHGA) rabbit polyclonal antibody, Serum
| Applications | IF, IHC |
| Reactivities | Human, Porcine |
| Conjugation | Unconjugated |
| Immunogen | Synthetic Pancreastatin. |
Rabbit Polyclonal Gastrokine 1 Antibody
| Applications | WB |
| Reactivities | Human, Equine, Porcine, Primate |
| Conjugation | Unconjugated |
| Immunogen | The portions of amino acids range between 100-150 of human GKN1 was used as the immunogen. |
Oxytocin neurophysin 1 (OXT) rabbit polyclonal antibody, Serum
| Applications | IF, IHC |
| Reactivities | Porcine |
| Conjugation | Unconjugated |
| Immunogen | Oxytocin conjugated to bovine thyroglobuline |
TAC1 rabbit polyclonal antibody, Serum
| Applications | IF, IHC |
| Reactivities | Fish, Human, Porcine, Rat |
| Conjugation | Unconjugated |
| Immunogen | Substance K / Neurokinin A (Peninsula) conjugated to BSA |
ProDynorphin (PDYN) (1-13) rabbit polyclonal antibody, Serum
| Applications | IHC, R |
| Reactivities | Guinea Pig, Hamster, Human, Monkey, Porcine, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide, YGGFLRRQFKVVT, corresponding to full-length porcine dynorphin B (1-13), conjugated to thyroglobulin. |
VIP rabbit polyclonal antibody, Serum
| Applications | IHC |
| Reactivities | Feline, Fish, Human, Mammalian, Porcine, Rat |
| Conjugation | Unconjugated |
| Immunogen | Purified porcine VIP. |
Germany
Japan
United Kingdom
China
