AR Rabbit monoclonal antibody
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
AR Rabbit monoclonal antibody
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
USD 516.00
In Stock
Rabbit monoclonal anti-ER Antibody, clone OTIR3C2
Applications | ELISA, IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Rabbit Polyclonal Anti-RXRA Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-RXRA Antibody: synthetic peptide directed towards the N terminal of human RXRA. Synthetic peptide located within the following region: DTKHFLPLDFSTQVNSSLTSPTGRGSMAAPSLHPSLGPGIGSPGQLHSPI |
Rabbit polyclonal GR (Ab-211) antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human GR around the phosphorylation site of serine 211 (N-E-S-P-W). |
Rabbit polyclonal NURR1 (NR4A2) Antibody (N-term)
Applications | IF, IHC, WB |
Reactivities | Human, Mouse (Predicted: Rat, Bovine) |
Conjugation | Unconjugated |
Immunogen | This NURR1 (NR4A2) antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 13-42 amino acids from the N-terminal region of human NURR1 (NR4A2). |
Rabbit polyclonal Retinoid X Receptor gamma antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from human Retinoid X Receptor ? antibody. |
Rabbit polyclonal Nuclear Receptor NR4A1 (Ab-351) antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human Nuclear Receptor NR4A1 around the phosphorylation site of serine 351 (L-P-SP-K-P). |
Rabbit polyclonal ESRRA Antibody (Center)
Applications | FC, IF, IHC, WB |
Reactivities | Human (Predicted: Mouse, Rat) |
Conjugation | Unconjugated |
Immunogen | This ESRRA antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 131-159 amino acids from the Central region of human ESRRA. |
Rabbit Polyclonal Anti-TRIP4 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human TRIP4 |
Rabbit Polyclonal Anti-ESR2 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human ESR2 |
Rabbit Polyclonal Anti-NR3C1 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human NR3C1 |
Rabbit Polyclonal Anti-PGRMC2 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human PGRMC2 |
Rabbit Polyclonal Anti-RORB Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human RORB |
Aryl hydrocarbon Receptor (AHR) (N-term) rabbit polyclonal antibody
Applications | ELISA, IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic AhR peptide - KLH conjugated |
Rabbit polyclonal HNF4A Antibody (Center)
Applications | FC, IF, IHC, WB |
Reactivities | Human, Rat (Predicted: Mouse) |
Conjugation | Unconjugated |
Immunogen | This HNF4A antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 281-312 amino acids from the Central region of human HNF4A. |