Antibodies

Jump to Filters
View as table Download
SOCS7 Rabbit Polyclonal Antibody
TA322370

USD 380.00

In Stock

Anti-SOCS7 Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 6-20 amino acids of human suppressor of cytokine signaling 7
SOCS7 Rabbit Polyclonal Antibody
TA322371

USD 380.00

In Stock

Anti-SOCS7 Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 6-20 amino acids of human suppressor of cytokine signaling 7
SOCS7 Rabbit Polyclonal Antibody
TA335617

USD 539.00

5 Days

Rabbit Polyclonal Anti-SOCS7 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-SOCS7 Antibody: synthetic peptide directed towards the N terminal of human SOCS7. Synthetic peptide located within the following region: LDPKALPPGLALERTWGPAAGLEAQLAALGLGQPAGPGVKTVGGGCCPCP
SOCS7 Rabbit Polyclonal Antibody
TA335618

USD 539.00

5 Days

Rabbit Polyclonal Anti-SOCS7 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-SOCS7 Antibody is: synthetic peptide directed towards the N-terminal region of Human SOCS7. Synthetic peptide located within the following region: GSAGRELDAGRKPKLTRTQSAFSPVSFSPLFTGETVSLVDVDISQRGLTS