SOCS7 Rabbit Polyclonal Antibody

CAT#: TA335618

Rabbit Polyclonal Anti-SOCS7 Antibody

Product Images

Host: Rabbit; Target Name: SOCS7; Sample Tissue: Breast Tumor lysates; Antibody Dilution: 1.0 ug/ml

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-SOCS7 Antibody is: synthetic peptide directed towards the N-terminal region of Human SOCS7. Synthetic peptide located within the following region: GSAGRELDAGRKPKLTRTQSAFSPVSFSPLFTGETVSLVDVDISQRGLTS
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 36 kDa
• Gene Name: suppressor of cytokine signaling 7
• Database Link:
  NP_055413
  Entrez Gene 30837 Human
  UniProt ID O14512
• Background: SOCS7 regulates signaling cascades probably through protein ubiquitination and/or sequestration. It functions in insulin signaling and glucose homeostasis through IRS1 ubiquitination and subsequent proteasomal degradation. It inhibits also prolactin, growth hormone and leptin signaling by preventing STAT3 and STAT5 activation, sequestering them in the cytoplasm and reducing their binding to DNA. SOCS7 may be a substrate recognition component of a SCF-like E3 ubiquitin-protein ligase complex which mediates the ubiquitination and subsequent proteasomal degradation of target proteins.
• Synonyms: NAP4; NCKAP4
• Note: Immunogen Sequence Homology: Horse: 100%; Human: 100%; Bovine: 100%; Rabbit: 100%; Dog: 92%; Pig: 92%; Rat: 92%; Mouse: 85%; Guinea pig: 83%

Reference Data

• Protein Families: Druggable Genome
• Protein Pathways: Jak-STAT signaling pathway