Antibodies

View as table Download

Anti-SHBG Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 68-81 amino acids of Human sex hormone-binding globulin

Anti-SHBG Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 68-81 amino acids of Human sex hormone-binding globulin

Rabbit Polyclonal Anti-SHBG Antibody

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen SHBG antibody was raised against a 16 amino acid peptide near the center of human SHBG.

Sex Hormone Binding Globulin (SHBG) (N-term) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen KLH conjugated synthetic peptide between 69-96 amino acids from the N-terminal region of Human SHBG.

Rabbit Polyclonal Anti-SHBG Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SHBG antibody is: synthetic peptide directed towards the C-terminal region of SHBG. Synthetic peptide located within the following region: RGEDSSTSFCLNGLWAQGQRLDVDQALNRSHEIWTHSCPQSPGNGTDASH

Rabbit Polyclonal Anti-SHBG Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SHBG antibody is: synthetic peptide directed towards the N-terminal region of Human SHBG. Synthetic peptide located within the following region: FDLTKITKTSSSFEVRTWDPEGVIFYGDTNPKDDWFMLGLRDGRPEIQLH