Sex Hormone Binding Globulin (SHBG) Rabbit Polyclonal Antibody

CAT#: TA343266

Rabbit Polyclonal Anti-SHBG Antibody

Product Images

WB Suggested Anti-SHBG Antibody; Titration: 1.0 ug/ml; Positive Control: Hela Whole Cell

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-SHBG antibody is: synthetic peptide directed towards the C-terminal region of SHBG. Synthetic peptide located within the following region: RGEDSSTSFCLNGLWAQGQRLDVDQALNRSHEIWTHSCPQSPGNGTDASH
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 31 kDa
• Gene Name: sex hormone binding globulin
• Database Link:
  NP_001139753
  Entrez Gene 6462 Human
  UniProt ID P04278
• Background: This gene encodes a steroid binding protein that was first described as a plasma protein secreted by the liver but is now thought to participate in the regulation of steroid responses. The encoded protein binds each steroid molecule as a dimer formed from identical or nearly identical monomers. The use of alternate promoters and alternatively spliced transcripts have been described. Multiple transcript variants encoding different isoforms have been found for this gene.
• Synonyms: ABP; SBP; TEBG
• Note: Immunogen Sequence Homology: Human: 100%; Rabbit: 86%

Reference Data

• Protein Families: Druggable Genome, Secreted Protein