Sex Hormone Binding Globulin (SHBG) (NM_001146279) Human Recombinant Protein

CAT#: TP328307

Recombinant protein of human sex hormone-binding globulin (SHBG), transcript variant 2, 20 µg

Product Images

Coomassie blue staining of purified SHBG protein (Cat# TP328307). The protein was produced from HEK293T cells transfected with SHBG cDNA clone (Cat# RC228307) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC228307 representing NM_001146279
  Red=Cloning site Green=Tags(s)
  
  MESRGPLATSRLLLLLLLLLLRHTRQGWALRPVLPTQSAHDPPAVHLSNGPGQEPIAVMTFDLTKITKTS
  SSFEVRTWDPEGVIFYGDTNPKDDWFMLGLRDGRPEIQLHNHWAQLTVGAGPRLDDGRWHQVEVKMEGDS
  VLLEVDGEEVLRLRQVSGPLTSKRHPIMRIALGGLLFPASNLRLPAEISASAPTSLRSCDVESNPGIFLP
  PGTQAEFNLRDIPQPHAEPWAFSLDLGLKQAAGSGHLLALGTPENPSWLSLHLQDQKVVLSSGSGPGLDL
  PLVLGLPLQLKLSMSRVVLSQGSKMKALALPPLGLAPLLNLWAKPQGRLFLGALPGEDSSTSFCLNGLWA
  QGQRLDVDQALNRSHEIWTHSCPQSPGNGTDASH
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 38.4 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Preparation: NULL or Add: Recombinant proteins was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_001139751
• Locus ID: 6462
• UniProt ID: P04278, B0FWH2
• Cytogenetics: 17p13.1
• Refseq ORF: 1152
• Synonyms: ABP; SBP; TEBG
• Summary: This gene encodes a steroid binding protein that was first described as a plasma protein secreted by the liver but is now thought to participate in the regulation of steroid responses. The encoded protein transports androgens and estrogens in the blood, binding each steroid molecule as a dimer formed from identical or nearly identical monomers. Polymorphisms in this gene have been associated with polycystic ovary syndrome and type 2 diabetes mellitus. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jan 2014]
• Protein Families: Druggable Genome, Secreted Protein