Antibodies

View as table Download

Rabbit Polyclonal Antibody against TARDBP

Applications ELISA, ICC/IF, IHC, WB
Reactivities Human, Primate, Mouse, Xenopus, Zebrafish, Chicken
Conjugation Unconjugated
Immunogen A synthetic peptide to a C-terminal region [within residues 350-414] of the human TARDBP protein. [Swiss-Prot# Q13148]

Rabbit polyclonal HDAC9 Antibody (N-term)

Applications IF, IHC, IP, WB
Reactivities Human (Predicted: Mouse, Chicken)
Conjugation Unconjugated
Immunogen This HDAC9 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 2-32 amino acids from the N-terminal region of human HDAC9.

Rabbit Polyclonal antibody to PPP3CB (protein phosphatase 3, catalytic subunit, beta isozyme)

Applications IHC, WB
Reactivities Human, Mouse (Predicted: Chicken, Rabbit, Rat, Xenopus, Bovine, X. tropicalis)
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 1 and 228 of PPP3CB (Uniprot ID#P16298)

Rabbit polyclonal SMAD3-S208 Antibody

Applications FC, IF, IHC, WB
Reactivities Human, Mouse (Predicted: Rat, Chicken, Pig)
Conjugation Unconjugated
Immunogen This SMAD3 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 186-215 amino acids from human SMAD3.

Rabbit Polyclonal Antibody against SOX2 (N-term)

Applications FC, IF, IHC, WB
Reactivities Human (Predicted: Mouse, Zebrafish, Chicken, Xenopus)
Conjugation Unconjugated
Immunogen This SOX2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 89-119 amino acids from the N-terminal region of human SOX2.

Rabbit polyclonal anti-TBP antibody, Loading control

Applications FC, IF, IHC, WB
Reactivities Human (Predicted: Mouse, Zebrafish, Bovine, Chicken, Monkey, Xenopus)
Conjugation Unconjugated
Immunogen This TBP antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 210-239 amino acids from the Central region of human TBP.

Rabbit polyclonal HDAC2 Antibody (Center)

Applications FC, IF, IHC, WB
Reactivities Human (Predicted: Mouse, Chicken)
Conjugation Unconjugated
Immunogen This HDAC2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 410-439 amino acids from the Central region of human HDAC2.

Rabbit polyclonal ENO1 Antibody (Center)

Applications FC, IF, IHC, WB
Reactivities Human, Mouse (Predicted: Rat, Bovine, Chicken, Monkey, Xenopus)
Conjugation Unconjugated
Immunogen This ENO1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 178-205 amino acids from the Central region of human ENO1.

Rabbit polyclonal FOXG1 Antibody (Center)

Applications FC, IF, WB
Reactivities Human, Mouse (Predicted: Rat, Chicken, Drosophila, Xenopus)
Conjugation Unconjugated
Immunogen This FOXG1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 225-252 amino acids from the Central region of human FOXG1.

Rabbit polyclonal antibody to ERG (v-ets erythroblastosis virus E26 oncogene homolog (avian))

Applications IF, WB
Reactivities Human (Predicted: Rat, Pig, Chicken, X. tropicalis)
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region within amino acids 419 and 486 of ERG (Uniprot ID#P11308)

Rabbit polyclonal TARDBP Antibody (N-term)

Applications IF, IHC, WB
Reactivities Human, Mouse (Predicted: Chicken)
Conjugation Unconjugated
Immunogen This TARDBP antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 1-30 amino acids from the N-terminal region of human TARDBP.

Rabbit Polyclonal Anti-HIF1A Antibody

Applications WB
Reactivities Human, Chicken, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-HIF1A antibody: synthetic peptide directed towards the middle region of human HIF1A. Synthetic peptide located within the following region: VKGCKSSEQNGMEQKTIILIPSDLACRLLGQSMDESGLPQLTSYDCEVNA

Rabbit Polyclonal antibody to Flightless I (flightless I homolog (Drosophila))

Applications IF, WB
Reactivities Human, Mouse (Predicted: Chicken, Rat, X. tropicalis)
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 435 and 778 of Flightless I (Uniprot ID#Q13045)

Rabbit polyclonal JUN Antibody (C-term)

Applications FC, IHC, WB
Reactivities Human (Predicted: Mouse, Rat, Bovine, Chicken, Pig)
Conjugation Unconjugated
Immunogen This JUN antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 222-251 amino acids from the C-terminal region of human JUN.

Rabbit polyclonal antibody to PSMC3 (proteasome (prosome, macropain) 26S subunit, ATPase, 3)

Applications IF, IHC, WB
Reactivities Human (Predicted: Zebrafish, Chicken, Bovine, Rhesus Monkey, X. tropicalis, Mouse)
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 51 and 361 of PSMC3 (Uniprot ID#P17980)