Rabbit Polyclonal Anti-GABRB1 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human GABRB1 |
Rabbit Polyclonal Anti-GABRB1 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human GABRB1 |
Rabbit Polyclonal Anti-GABRA1 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human GABRA1 |
Anti-GLRA1 Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 141-155 amino acids of human glycine receptor, alpha 1 |
Rabbit Polyclonal Anti-GAMT Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human GLRA1 |
Rabbit polyclonal GABRA2 Antibody (C-term)
Applications | FC, IHC, WB |
Reactivities | Human (Predicted: Mouse, Rat, Bovine) |
Conjugation | Unconjugated |
Immunogen | This GABRA2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 378-406 amino acids from the C-terminal region of human GABRA2. |
Rabbit Polyclonal Anti-GABA (A) alpha3 Receptor (extracellular)
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Peptide QGESRRQEPGDFVKQ(C), corresponding to amino acid residues 29-43 of human GABA (A) a3 Receptor. Extracellular, N-terminus. |
Rabbit Polyclonal Anti-GABRG2 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human GABRG2 |
Rabbit Polyclonal Anti-GABRD Antibody
Applications | IHC, WB |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-GABRD antibody: synthetic peptide directed towards the N terminal of human GABRD. Synthetic peptide located within the following region: MDAPARLLAPLLLLCAQQLRGTRAMNDIGDYVGSNLEISWLPNLDGLIAG |
Rabbit polyclonal anti-GABRA4 antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human GABRA4. |
Rabbit polyclonal anti-GLRB antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human GLRB. |
Anti-GLRA1/GLRA2/GLRA3 Rabbit Polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 219-233 amino acids of Human glycine receptor, alpha 1 |
Anti-GLRA1 Rabbit Polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 141-155 amino acids of human glycine receptor, alpha 1 |
Rabbit Polyclonal GABA-RB (Ser434) Antibody (Phospho-specific)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against A synthesized peptide derived from human GABA-RB around the phosphorylation site of Serine 434 |
Modifications | Phospho-specific |
Anti-GABRR1 Rabbit Polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 57-70 amino acids of Human gamma-aminobutyric acid (GABA) A receptor, rho 1 |
GABA A Receptor alpha 1 (GABRA1) rabbit polyclonal antibody, Aff - Purified
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |