Rabbit polyclonal TK (Ab-13) antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human TK around the phosphorylation site of serine 13 (P-G-SP-P-S). |
Rabbit Polyclonal Anti-UMPS Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-UMPS antibody: synthetic peptide directed towards the C terminal of human UMPS. Synthetic peptide located within the following region: VGFISGSRVSMKPEFLHLTPGVQLEAGGDNLGQQYNSPQEVIGKRGSDII |
Rabbit polyclonal ITPA Antibody (N-term)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human (Predicted: Mouse, Rat, Bovine, Chicken, Xenopus) |
| Conjugation | Unconjugated |
| Immunogen | This ITPA antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 24-51 amino acids from the N-terminal region of human ITPA. |
Rabbit Polyclonal Anti-NP Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-NP antibody: synthetic peptide directed towards the middle region of human NP. Synthetic peptide located within the following region: GVDTLVVTNAAGGLNPKFEVGDIMLIRDHINLPGFSGQNPLRGPNDERFG |
Germany
Japan
United Kingdom
China
