Rabbit polyclonal anti-H3F3B(Histone H3) antibody, Loading control
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein fragment contain a sequence corresponding to a region within amino acids 1 and 86 of Histone H3.3B |
Rabbit Polyclonal antibody to Histone H2A.Z (H2A histone family, member Z)
| Applications | IF, IHC, IP, WB |
| Reactivities | Human (Predicted: Rat, Zebrafish, Xenopus, Pig, Chicken, Sheep, Bovine, Rhesus Monkey, X. tropicalis, Mouse) |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide contain a sequence corresponding to a region within amino acids 65 and 128 of Histone H2A.Z |
Rabbit Polyclonal Anti-ACTN1 Antibody - N-terminal region
| Applications | IHC, WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ACTN1 antibody: synthetic peptide directed towards the N terminal of human ACTN1. Synthetic peptide located within the following region: DHYDSQQTNDYMQPEEDWDRDLLLDPAWEKQQRKTFTAWCNSHLRKAGTQ |
Rabbit Anti-NMDA NR2B Subunit Antibody
| Applications | WB |
| Reactivities | Rat, Mouse, Human |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein from the C-terminal region of the NR2B subunit |
DiMethyl-Histone H3-K9 Rabbit Polyclonal Antibody
| Applications | ChIP, ChIP-seq, Dot, ICC/IF, IHC, IP, WB |
| Reactivities | Human, Mouse, Rat, Other (Wide Range) |
| Conjugation | Unconjugated |
| Immunogen | A synthetic methylated peptide corresponding to residues surrounding K9 of human histone H3 |
TriMethyl-Histone H3-K36 Rabbit Polyclonal Antibody
| Applications | ChIP, ChIP-seq, Dot, ICC/IF, IHC, IP, WB |
| Reactivities | Human, Mouse, Rat, Other (Wide Range) |
| Conjugation | Unconjugated |
| Immunogen | A synthetic tri-methylated peptide corresponding to residues surrounding K36 of human histone H3 |
MonoMethyl-Histone H3-K4 Rabbit Polyclonal Antibody
| Applications | ChIP, ChIP-seq, ICC/IF, IHC, IP, WB |
| Reactivities | Human, Mouse, Rat, Other (Wide Range) |
| Conjugation | Unconjugated |
| Immunogen | A synthetic methylated peptide corresponding to residues surrounding K4 of human histone H3 |
DiMethyl-Histone H3-K4 Rabbit Polyclonal Antibody
| Applications | ChIP, ChIP-seq, ICC/IF, IHC, IP, WB |
| Reactivities | Human, Mouse, Rat, Other (Wide Range) |
| Conjugation | Unconjugated |
| Immunogen | A synthetic methylated peptide corresponding to residues surrounding K4 of human histone H3 |
MonoMethyl-Histone H3-K9 Rabbit Polyclonal Antibody
| Applications | ChIP, ChIP-seq, Dot, ICC/IF, IHC, WB |
| Reactivities | Human, Mouse, Rat, Other (Wide Range) |
| Conjugation | Unconjugated |
| Immunogen | A synthetic methylated peptide corresponding to residues surrounding K9 of human histone H3 |
Germany
Japan
United Kingdom
China
