Antibodies

Jump to Filters
View as table Download
EGF Rabbit Polyclonal Antibody
TA324064

USD 380.00

In Stock

Anti-EGF Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 926-1026 amino acids of human epidermal growth factor
EGF Rabbit Polyclonal Antibody
PP1002P1

USD 345.00

2 Weeks

EGF rabbit polyclonal antibody, Aff - Purified

Applications ELISA, FN, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Highly pure (>98%) E.coli derived recombinant Human EGF (hEGF).
EGF Rabbit Polyclonal Antibody
PP1002P2

USD 465.00

2 Weeks

EGF rabbit polyclonal antibody, Aff - Purified

Applications ELISA, FN, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Highly pure (>98%) E.coli derived recombinant Human EGF (hEGF).
EGF Rabbit Polyclonal Antibody
AP20662PU-N

USD 465.00

3 Weeks

EGF rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
EGF Rabbit Polyclonal Antibody
TA324063

USD 380.00

In Stock

Anti-EGF Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 926-1026 amino acids of human epidermal growth factor
EGF (Center) Rabbit Polyclonal Antibody
AP51384PU-N

USD 580.00

2 Weeks

EGF (Center) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen KLH conjugated synthetic peptide between 689-720 amino acids from the Central region of human EGF
EGF Rabbit Polyclonal Antibody
TA346085

USD 539.00

2 Weeks

Rabbit Polyclonal Anti-EGF Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-EGF antibody: synthetic peptide directed towards the middle region of human EGF. Synthetic peptide located within the following region: ITIDFLTDKLYWCDAKQSVIEMANLDGSKRRRLTQNDVGHPFAVAVFEDY
EGF Rabbit Polyclonal Antibody
TA347892

USD 380.00

4 Weeks

Rabbit Polyclonal Anti-EGF Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-EGF Antibody: A synthesized peptide derived from human EGF