Rabbit Polyclonal CD4 Antibody
| Applications | FC, ICC/IF, IHC, Simple Western, WB |
| Reactivities | Human, Mouse, Rat, Rabbit |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide made to an C-terminal region of the human CD4 protein (within residues 400-458). [Swiss-Prot P01730] |
Rabbit Polyclonal Antibody against SOX2 - Embryonic Stem Cell Marker
| Applications | FC, ICC/IF, IHC, WB |
| Reactivities | Human, Mouse, Sheep |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide made to the N-terminal region of human SOX2 protein (within residues 1-100). [Swiss-Prot# P48431] |
Rabbit Polyclonal Antibody against OCT4 - Embryonic Stem Cell Marker
| Applications | FC, ICC/IF, IHC, WB |
| Reactivities | Human, Monkey |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide made to an internal portion of the human OCT4 protein sequence (between residues 100-200). |
Rabbit polyclonal KLF4 Antibody (N-term C74)
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | This KLF4 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 69-101 amino acids from the N-terminal region of human KLF4. |
Rabbit polyclonal EGFR (Ab-1172) antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human EGFR around the phosphorylation site of tyrosine 1172 (P-D-YP-Q-Q). |
Rabbit Polyclonal Antibody against CD9 (Center)
| Applications | FC, IF, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This CD9 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 115-145 amino acids from the Central region of human CD9. |
Rabbit Polyclonal Anti-SOX10 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-SOX10 Antibody: synthetic peptide directed towards the middle region of human SOX10. Synthetic peptide located within the following region: PGGEAEQGGTAAIQAHYKSAHLDHRHPGEGSPMSDGNPEHPSGQSHGPPT |
Rabbit Polyclonal antibody to CD44 (CD44 molecule (Indian blood group))
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein fragment contain a sequence corresponding to a region within amino acids 1 and 258 of CD44 |
Rabbit polyclonal anti-BDNF antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This IgG fraction antibody was prepared from rabbit antiserum after repeated immunizations with recombinant truncated human BDNF protein produced in E.coli. |
Germany
Japan
United Kingdom
China
