Rabbit Polyclonal Anti-NEU1 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-NEU1 antibody: synthetic peptide directed towards the middle region of human NEU1. Synthetic peptide located within the following region: VWSKDDGVSWSTPRNLSLDIGTEVFAPGPGSGIQKQREPRKGRLIVCGHG |
Rabbit Polyclonal Anti-ACER1 Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ACER1 antibody: synthetic peptide directed towards the C terminal of human ACER1. Synthetic peptide located within the following region: VNAYALNSIALHILYIVCQEYRKTSNKELRHLIEVSVVLWAVALTSWISD |
UGT8 rabbit polyclonal antibody, Purified
| Applications | ELISA, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide derived from Human Ceramide Glycosyltransferase Protein |
Germany
Japan
United Kingdom
China
