Antibodies

View as table Download

Rabbit Polyclonal antibody to ALPPL2 (alkaline phosphatase, placental-like 2)

Applications IF, IHC, WB
Reactivities Human (Predicted: Mouse)
Conjugation Unconjugated
Immunogen Recombinant fragment contain a sequence corresponding to a region within amino acids 46 and 344 of ALPPL2 (Uniprot ID#P10696)

Rabbit polyclonal ALPL Antibody (Center)

Applications FC, IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen This ALPL antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 217-246 amino acids from the Central region of human ALPL.

Rabbit Polyclonal Anti-ALPP Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Fusion protein of human ALPP

Anti-ALPL Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 2-329amino acids of Human Alkaline phosphatase

Rabbit Polyclonal Anti-ALPI Antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Fusion protein of human ALPI

Anti-ALPL Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 2-329 amino acids of Human Alkaline phosphatase

Anti-ALPPL2 Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 420-434 amino acids of human alkaline phosphatase, placental-like 2

Rabbit polyclonal antibody to alkaline phosphatase(intestinal) (alkaline phosphatase, intestinal)

Applications IHC, WB
Reactivities Human (Predicted: Mouse, Rat, Bovine)
Conjugation Unconjugated
Immunogen Recombinant fragment contain a sequence corresponding to a region within amino acids 3 and 206 of Alkaline phosphatase (intestinal) (Uniprot ID#P09923)

Rabbit Polyclonal Anti-ALPP Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ALPP antibody: synthetic peptide directed towards the C terminal of human ALPP. Synthetic peptide located within the following region: TVLLYGNGPGYVLKDGARPDVTESESGSPEYRQQSAVPLDEETHAGEDVA

Alkaline Phosphatase (ALPL) (N-term) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a sequence at the N-terminal of Human ALPL (21-35)

Rabbit polyclonal antibody to alkaline phosphatase (liver/bone/kidney) (alkaline phosphatase, liver/bone/kidney)

Applications IHC, WB
Reactivities Human (Predicted: Mouse, Feline, Dog, Rat, Bovine)
Conjugation Unconjugated
Immunogen Recombinant fragment contain a sequence corresponding to a region within amino acids 1 and 359 of Alkaline Phosphatase (Tissue Non-Specific) (Uniprot ID#P05186)

Rabbit polyclonal Alkaline Phosphatase (ALPI) Antibody (Center)

Applications IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This Alkaline Phosphatase (ALPI) antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 274-304 amino acids from the Central region of human Alkaline Phosphatase (ALPI).

Alkaline Phosphatase (ALPP) (N-term) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen KLH conjugated synthetic peptide between 55-83 amino acids from the N-terminal region of human ALPP

ALPL Antibody - middle region

Applications WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human ALPL

Rabbit polyclonal antibody to Alkaline phosphatase(placental ) (alkaline phosphatase, placental (Regan isozyme))

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 163 and 387 of Placental Alkaline Phosphatase (Uniprot ID#P05187)