Antibodies

View as table Download

Rabbit Polyclonal antibody to Triosephosphate isomerase (triosephosphate isomerase 1)

Applications IF, IHC, WB
Reactivities Human (Predicted: Yeast, Dog, Chicken, Chimpanzee, Bovine, X. tropicalis)
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region within amino acids 187 and 249 of Triosephosphate isomerase (Uniprot ID#P60174)

Rabbit Polyclonal Antibody against ABCF2

Applications ICC/IF, Simple Western, WB
Reactivities Human, Yeast
Conjugation Unconjugated
Immunogen A fusion protein containing amino acids 1-102 of the ABCF2 protein.

Rabbit Polyclonal Anti-RHOC Antibody

Applications IHC, WB
Reactivities Human, Cow, Dog, Goat, Guinea Pig, Horse, Mouse, Rabbit, Rat, Sheep, Yeast, Zebrafish, Brugia malayi
Conjugation Unconjugated
Immunogen The immunogen for Anti-RHOC Antibody: synthetic peptide directed towards the N terminal of human RHOC. Synthetic peptide located within the following region: VPTVFENYIADIEVDGKQVELALWDTAGQEDYDRLRPLSYPDTDVILMCF

Rabbit Polyclonal RNA Polymerase II/POLR2A [p Thr4] Antibody

Applications Dot, WB
Reactivities Human, Chicken, Drosophila, Yeast
Conjugation Unconjugated
Immunogen A synthetic peptide made to a phosphorylated Threonine (position 4) of the CTD heptad in the human RNA polymerase II protein [UniProt P24928]

HXK1 rabbit polyclonal antibody, HRP

Applications ELISA, WB
Reactivities Yeast
Conjugation HRP
Immunogen Hexokinase  from Yeast

ATG12 rabbit polyclonal antibody, Purified

Applications ELISA, WB
Reactivities Saccharomyces cerevisiae, Yeast
Conjugation Unconjugated
Immunogen This purified antibody was prepared from rabbit serum after repeated immunizations with recombinant yeast APG12 protein.

ULP1 rabbit polyclonal antibody, Purified

Applications ELISA, WB
Reactivities Yeast
Conjugation Unconjugated
Immunogen Prepared from rabbit serum after repeated immunizations with recombinant yeast ULP-1 protein.

swi6 (314-328) rabbit polyclonal antibody, Aff - Purified

Applications ELISA, WB
Reactivities Yeast
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding aa 314-328 of S.pombe Swi6 protein

ATG8 rabbit polyclonal antibody, Purified

Applications ELISA, WB
Reactivities Yeast
Conjugation Unconjugated
Immunogen This purified antibody was prepared from rabbit serum after repeated immunizations with recombinant yeast APG8 protein.

HUB1 rabbit polyclonal antibody, Purified

Applications ELISA, WB
Reactivities Yeast
Conjugation Unconjugated
Immunogen This purified antibody was prepared from rabbit serum after repeated immunizations with recombinant yeast Hub1 protein.

URM1 rabbit polyclonal antibody, Purified

Applications ELISA, WB
Reactivities Yeast
Conjugation Unconjugated
Immunogen Recombinant yeast Urm1 protein.

RAD9A pSer1260 rabbit polyclonal antibody, Aff - Purified

Applications ELISA, WB
Reactivities Yeast
Conjugation Unconjugated
Immunogen This affinity purified antibody was prepared from whole rabbit serum produced by repeated immunizations with a synthetic peptide corresponding to phosphorylated form of aa 1249-1263 of 1309 of yeast Rad9 protein conjugated to KLH.

RAD9A pSer1129 rabbit polyclonal antibody, Aff - Purified

Applications ELISA, WB
Reactivities Yeast
Conjugation Unconjugated
Immunogen This affinity purified antibody was prepared from whole rabbit serum produced by repeated immunizations with a synthetic peptide corresponding to aa 1125-1139 of 1309 of yeast Rad9 protein conjugated to KLH.

GND1 rabbit polyclonal antibody, Aff - Purified

Applications ELISA, ID, IF, IP, R, WB
Reactivities Yeast
Conjugation Unconjugated
Immunogen 6-Phosphogluconic dehydrogenase isolated and purified from yeast. Freund’s complete adjuvant is used in the first step of the immunization procedure.

HXK1 rabbit polyclonal antibody, Serum

Applications ELISA, WB
Reactivities Yeast
Conjugation Unconjugated
Immunogen Hexokinase [Yeast].