Antibodies

Jump to Filters
View as table Download
SH2D1A Rabbit Polyclonal Antibody
TA326947

USD 365.00

3 Weeks

Rabbit anti-SH2D1A Polyclonal Antibody

Applications ICC/IF, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant protein of human SH2D1A
SH2D1A Rabbit Monoclonal Antibody [Clone ID: R09-5F6]
TA385238

USD 380.00

4 Weeks

SH2D1A Rabbit monoclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
SH2D1A Rabbit Polyclonal Antibody
AP05121PU-N

USD 580.00

5 Days

SH2D1A rabbit polyclonal antibody, Purified

Applications IP, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Full-length recombinant SAP protein
SH2D1A Rabbit Polyclonal Antibody
TA342926

USD 539.00

5 Days

Rabbit Polyclonal Anti-SH2D1A Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SH2D1A antibody: synthetic peptide directed towards the C terminal of human SH2D1A. Synthetic peptide located within the following region: YFRKIKNLISAFQKPDQGIVIPLQYPVEKKSSARSTQGTTGIREDPDVCL
SH2D1A Rabbit Polyclonal Antibody
TA342927

USD 539.00

5 Days

Rabbit Polyclonal Anti-SH2D1A Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SH2D1A antibody is: synthetic peptide directed towards the middle region of Human SH2D1A. Synthetic peptide located within the following region: YTYRVSQTETGSWSAETAPGVHKRYFRKIKNLISAFQKPDQGIVIPLQYP