Antibodies

Jump to Filters
View as table Download
GRPR Rabbit Polyclonal Antibody
TA316872

USD 515.00

2 Weeks

GRPR Rabbit Polyclonal (Extracellular Domain) Antibody

Applications IHC
Reactivities Bat, Dog, Gorilla, Human, Monkey, Pig, Rabbit, Gibbon, Horse (Predicted: Bovine)
Conjugation Unconjugated
Immunogen GRPR antibody was raised against synthetic 18 amino acid peptide from 2nd extracellular domain of human GRPR. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Marmoset, Elephant, Panda, Dog, Bat, Horse, Rabbit, Pig (100%); Bovine (94%); Mouse, Rat, Hamster (83%).
Calnexin (CANX) Rabbit Polyclonal Antibody
TA336278

USD 550.00

5 Days

Rabbit Polyclonal Calnexin Antibody

Applications FC, ICC/IF, IHC, IP, Simple Western, WB
Reactivities Human, Mouse, Rat, Bovine, Chicken, Avian, Drosophila
Conjugation Unconjugated
Immunogen A synthetic peptide made to an internal region of the canine Calnexin protein (within residues 25-100). [Swiss-Prot P24643]
COX4 (COX4I1) Rabbit Polyclonal Antibody
TA301446

USD 550.00

In Stock

Rabbit polyclonal anti-COX IV antibody, Loading control

Applications ChIP, ICC, ICC/IF, IHC, Simple Western, WB
Reactivities Human, Mouse, Bovine, Primate, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide made to an internal region of the human COX4-1 protein (within residues 1-100). [Swiss-Prot# P13073]
EMA (MUC1) Rabbit Polyclonal Antibody
TA336810

USD 550.00

5 Days

Rabbit Polyclonal MUC-1 Antibody

Applications FC, ICC/IF, IHC, WB
Reactivities Human, Mouse, Rat, Bovine, Equine, Guinea Pig, Porcine
Conjugation Unconjugated
Immunogen Synthetic peptides corresponding to MUC1(mucin 1, cell surface associated) The peptide sequence was selected from the C terminal region between aa 1200-1250 of human MUC1 (NP_001037855). Peptide sequence GQLDIFPARDTYHPMSEYPTYHTHGRYVPPSSTDRSPYEKVSAGNGGSSL.
WNT11 Rabbit Polyclonal Antibody
TA308507

USD 625.00

3 Weeks

Rabbit Polyclonal antibody to WNT11 (wingless-type MMTV integration site family, member 11)

Applications IF, IHC, WB
Reactivities Human, Mouse (Predicted: Chicken, Rat, Xenopus, Bovine)
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 1 and 310 of WNT11 (Uniprot ID#O96014)
SCARB1 Rabbit Polyclonal Antibody
TA336639

USD 605.00

5 Days

Rabbit Polyclonal SR-BI Antibody

Applications Block/Neutralize, FC, ICC/IF, IHC, Immunoblotting, IP, Simple Western, WB
Reactivities Human, Mouse, Rat, Bovine, Hamster, Mustelid
Conjugation Unconjugated
Immunogen A C-terminal peptide containing residues from mouse SR-BI (within residues 450-509). [UniProt# Q61009]
BCL2L2 Rabbit Polyclonal Antibody
TA302168

USD 580.00

5 Days

Rabbit Polyclonal Antibody against BCL2L2

Applications IHC, WB
Reactivities Human, Mouse (Predicted: Bovine)
Conjugation Unconjugated
Immunogen This Bcl antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 24-59 amino acids from human Bcl.
alpha 1a Adrenergic Receptor (ADRA1A) Rabbit Polyclonal Antibody
TA308493

USD 625.00

5 Days

Rabbit Polyclonal antibody to alpha 1a Adrenergic Receptor (adrenergic, alpha-1A-, receptor)

Applications IF, IHC, WB
Reactivities Human (Predicted: Bovine, Dog, Pig, Rabbit, Guinea Pig, Rhesus Monkey)
Conjugation Unconjugated
Immunogen Synthetic peptide contain a sequence corresponding to a region within amino acids 206 and 260 of alpha 1a Adrenergic Receptor (Uniprot ID#P35348)
Semaphorin 3B (SEMA3B) Rabbit Polyclonal Antibody
TA309848

USD 550.00

5 Days

Rabbit Polyclonal SEMA3B Antibody

Applications ICC/IF, IHC, Simple Western, WB
Reactivities Bovine, Canine, Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide made to an internal portion of the human SEMA 3B protein sequence (between residues 100-200).
ARV1 (N-term) Rabbit Polyclonal Antibody
AP50263PU-N

USD 580.00

2 Weeks

ARV1 (N-term) rabbit polyclonal antibody, Aff - Purified

Applications FC, IHC, WB
Reactivities Bovine, Human, Mouse
Conjugation Unconjugated
Immunogen KLH conjugated synthetic peptide between 23-51 amino acids from the N-terminal region of human ARV1.
TLR3 (514-657) Rabbit Polyclonal Antibody
AP23628PU-N

USD 535.00

2 Weeks

TLR3 (514-657) rabbit polyclonal antibody, Aff - Purified

Applications IF, IHC, WB
Reactivities Bovine, Feline, Guinea Pig, Human, Monkey, Mouse, Porcine, Rabbit, Rat
Conjugation Unconjugated
Immunogen TLR3 antibody was raised against recombinant protein fragment containing a sequence corresponding to a region within amino acids 514 and 657 of TLR3.
CD41 (ITGA2B) Rabbit Polyclonal Antibody
TA308579

USD 625.00

5 Days

Rabbit polyclonal antibody to CD41/Integrin alpha 2b (integrin, alpha 2b (platelet glycoprotein IIb of IIb/IIIa complex, antigen CD41))

Applications IHC, WB
Reactivities Human (Predicted: Dog, Bovine)
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 210 and 532 of Integrin alpha 2b (Uniprot ID#P08514)
VRL1 (TRPV2) Rabbit Polyclonal Antibody
TA317464

USD 515.00

2 Weeks

TRPV2 Rabbit Polyclonal (N-Terminus) Antibody

Applications IHC
Reactivities Gorilla, Human, Monkey, Pig, Horse (Predicted: Bovine, Hamster, Rabbit)
Conjugation Unconjugated
Immunogen VRL1 / TRPV2 antibody was raised against synthetic 15 amino acid peptide from N-terminus of human TRPV2. Percent identity with other species by BLAST analysis: Human, Gorilla, Monkey, Horse, Pig (100%); Gibbon, Bovine, Hamster, Panda, Rabbit (93%); Mouse, Dog (87%); Elephant (80%).
NPFF1 Receptor (NPFFR1) Rabbit Polyclonal Antibody
TA317553

USD 515.00

2 Weeks

NPFF1 / NPFFR1 Rabbit Polyclonal (Extracellular Domain) Antibody

Applications IHC
Reactivities Bovine, Gorilla, Human, Monkey, Pig, Rabbit, Gibbon, Horse (Predicted: Mouse, Rat, Dog)
Conjugation Unconjugated
Immunogen NPFFR1 / GPR147 antibody was raised against synthetic 20 amino acid peptide from 2nd extracellular domain of human NPFF1 Receptor. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Marmoset, Bovine, Horse, Rabbit, Pig (100%); Mouse, Rat, Dog, Panda (95%); Elephant, Turkey, Chicken (85%); Opossum, Platypus (80%).
EXT2 Rabbit Polyclonal Antibody
TA325104

USD 580.00

5 Days

Rabbit polyclonal EXT2 Antibody (Center)

Applications FC, IF, IHC, WB
Reactivities Human (Predicted: Mouse, Bovine)
Conjugation Unconjugated
Immunogen This EXT2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 182-209 amino acids from the Central region of human EXT2.